Laporan Tahunan 2011 Annual Report - Report 2011.pdf · Laporan Tahunan 2011 Annual Report ... daerah…

  • Published on
    02-Mar-2019

  • View
    212

  • Download
    0

Transcript

BroadeningLaporan Tahunan 2011 Annual Report

The Horizon

KANTOR PUSAT Head Office

Gedung Plaza City View Lantai 1Jl. Kemang Timur No. 22Jakarta 12510Tel. 021 - 719 3888Fax. 021 - 719 3889

www.sieradproduce.com

Annual ReportLaporan Tahunan 2011

ContentsDaftar Isi

Kinerja SahamStock Performance 16

Laporan Dewan KomisarisReport from the Board of Commissioners 18

Laporan DireksiReport from the Board of Directors 24

6 Visi MisiVision Mission

2 Sekilas PerusahaanCompany in Brief

12 Ikhtisar KeuanganFinancial Highlights

8 Peristiwa PentingEvent Highlights

Profil Dewan KomiasarisBoard of Commissioners Profile 76

Profil DireksiBoard of Directors Profile 78

Profil Komite AuditAudit Committees Profile 82

Sekretaris PerusahaanCorporate Secretary 84

Alamat PerusahaanCompany Address 85

Struktur OrganisasiOrganization Structure 87

PernyataanStatement 88

Laporan Keuangan Financial Report 89

Tata Kelola PerusahaanCorporate Governance40Laporan Komite AuditAudit Committee Report56

Tanggung Jawab Sosial PerusahaanCorporate Social Responsibility

58

Analisa & Pembahasan ManajemenManagement Analysis & Discussion

60

Sumber Daya ManusiaHuman Resources32

74 Data PerusahaanCorporate Data

II Laporan Tahunan 2011 Sierad Produce

12011 Annual Report Sierad Produce

BroadeningThe Horizon

Semangat untuk memperluas cakrawala bisnis telah menginspirasi Sierad Produce sepanjang tahun 2011. Perluasan usaha baik dengan memperpanjang rantai integrasi berupa lini usaha di bidang makanan olahan, maupun dengan menambah kapasitas produksi dan daerah operasi, turut mendukung pertumbuhan bisnis Perseroan secara menyeluruh dan berkesinambungan.

The spirit to expand the business horizons has inspired Sierad Produce throughout the year 2011. Business expansion either by extending the chain of integration in the form of business lines in processed foods, as well as to increase production capacity and operating areas, has contributed to the Companys overall business growth and sustainable.

2 Laporan Tahunan 2011 Sierad Produce

Company in BriefSekilas Perusahaan

SieradAbout

32011 Annual Report Sierad Produce

PT Sierad Produce Tbk (Sierad Produce/Perseroan) merupakan hasil merger 4 (empat) perusahaan yang bergerak dalam bidang usaha perunggasan terpadu, yaitu PT Anwar Sierad Tbk, PT Sierad Produce Tbk, PT Sierad Feedmill dan PT Sierad Grains. Keempat perusahaan ini bergabung pada tahun 2001.

PT Sierad Produce is an entity resulting from the merger of 4 (four) companies conducting the integrated poultry business, namely PT Anwar Sierad Tbk, PT Sierad Produce Tbk, PT Sierad Feedmill and PT Sierad Grains. These companies have joined in 2001.

4 Laporan Tahunan 2011 Sierad Produce

Sierad Produce didirikan pada tanggal 6 September 1985 dengan nama PT Betara Darma Ekspor & Impor. Nama Sierad Produce mulai digunakan pada saat persiapan untuk public listing di Bursa Efek Jakarta, 27 Desember 1996.

Bisnis utama Sierad Produce saat ini terdiri dari: Pakanternak Peternakanayamindukdanpenetasantelur Kemitraan(peternakanayamkomersial) RumahPotongAyam(RPA) ProdusenMakananOlahan Ritel Produsenperalatanpeternakan Produsentepungikan

Padatanggal29November1996,Perseroanmemperolehpenyataan efektif dari Ketua Badan Pengawas PasarModal (BAPEPAM) dengan suratnya No. S-1946/PM/1996 untuk melakukan penawaran umum atas250.0000.000 saham kepada masyarakat dengan nilainominal Rp 500 per saham. Sejak saat itu, Perseroantelahmelakukanhal-halsbb:

TahunYear

Keterangan Description

Jumlah Saham Beredar Total shares outstanding

(Saham | Share)

1997 Penerbitan 76.436.000 lembar saham seri A dengan nilai nominal Rp 500 dari konversiobligasi.Issuance of 76,436,000 A series shares with par value of Rp 500 from conversion ofbonds.

726.436.000

1998 KonversiObligasi|Conversion of bonds 730.999.0002001 PenerbitansahamseriBsejumlah6.506.866.083sahamdengannominalRp300,sehingga

sahamberedarmenjadi:Issuance of. 6,506,866,083 B series shares with par value of Rp 300, therefore totaloutstandingsharesare:

SeriA|A series 730.999.000 SeriB|B series 6.506.866.083

2004 Penggabungansahamsebesar10kali,sehinggasahamyangberedarmenjadi:Reversestocksplitof10times,thereforetheCompanyssharesare:

SeriA|A series 73.099.900 SeriB|B series 650.686.609

2005 KonversiHutangObligasiKonversidanHutangSewaGunaUsaha,sehinggasahamyangberedarmenjadi:Conversionofconvertiblebondsandfinanceleaseliabilities,thereforetheoutstandingsharesare:

seriA|A series 73.099.900 seriB|B series 650.686.609 seriC|C series 8.667.321.984

Sierad Produce, formerly known as PT Betara DarmaEkspor & Impor, was incorporated on 6 September1985.ItscurrentnamewasadoptedinpreparationforitssuccessfulpubliclistingontheJakartaStockExchange.on 27 December 1996.

Nowadays,SieradProducesbusinessesare: Feedmill Breedingandhatchery Partnership(growingfarm) Slaughterhouse FoodProcessing Retailer Poultryequipmentindustry Fishmealindustry

On November, 29, 1996, the Company received aneffective statement from the chairman of BadanPengawas Pasar Modal (BAPEPAM) in his letter No. S-1946/PM/1996 to do a public offering of250,0000,000 shares to the public with nominal valueofRp500pershare.Sincethen,theCompanyhasdonethefollowingthings:

52011 Annual Report Sierad Produce

Selainitudapatdiinformasikanpula,bahwapertanggal31 Desember 2011, di dalam Perseroan tidak terdapat DewanKomisarisdan/atauDireksiyangmemilikisahamPerseroan.

Selama hampir tiga dasawarsa, Sierad Produce telahtumbuhmenjadikelompokusahayangmaju,berkantorpusat di Indonesia, dan bergerak di bidang peternakan ayam terpadu. Seiring dengan perjalanan bisnisnya,Sierad Produce berhasil membuktikan keunggulannyamelalui komitmen untuk senantiasa mendukung strategi Pemerintah dalam rangka pemenuhan kebutuhanakan protein hewani dengan harga terjangkau bagiseluruhmasyarakatIndonesia.Halinidilakukandenganpengelolaanperusahaansecarabertanggungjawabdansenantiasa berupaya meningkatkan nilai Perseroan, serta memberikan tingkat pengembalian bagi pemegang saham dan pemangku kepentingan lainnya. SieradProduce berkomitmen untuk terus mengejar berbagaipeluang guna mengembangkan kegiatan usahanya dibidangperunggasandanmakananjadi.

Moreover, it can also be informed, that as of 31December 2011, in the Company was not found theBoardofDirectorsand/ortheBoardofCommissionerswhohastheCompanysshares.

For almost 30 years, Sierad Produce has grown intoadvancedbusinessgroup,headquartered in Indonesia,and engaged moving in the field of an integratedpoultryindustry.Alongwithitsbusinessjourney,SieradProduceproveditsexcellencethroughacommitmenttosupportthegovernmentstrategyinordertofulfillaneedof animal protein with affordable price for Indonesianpeople.Thisisdonethroughtheresponsiblecorporatemanagement and constantly working to improve thevalueoftheCompanyaswellastoproviderateofreturnto the shareholders and other stakeholders. SieradProduce committed to pursue various opportunities to developitspoultryandfood-basedbusinessactivities.

STRUKTUR ANAK PERUSAHAAN | STRUCTURE OF SUBSIDIARIES

Anak Perusahaan Subsidiaries

Domisili Domicile

Bidang UsahaBusiness

Presentase Pemilikan (langsung dan tidak langsung)

Percentage of Ownership (direct

and indirect)

Tahun Operasi

KomersialYear of

Commercial Operation

Jumlah Aset Sebelum Eliminasi

Total Assets before Elimination

2011 2010 2011 2010

PT Sierad Industries Jakarta

Industri peralatan peternakan ayamPoultryequipmentindustry

99,54% 99,40% 1996 80.980.639.501 64.215.448.163

PTDwipaMinaNusantara Bali

Industri tepung ikanFishmealindustry 100% 100% 1996 2.534.273.245 2.940.531.483

PT Sierad Pangan Nusantara Jakarta

Industri makanan dan minumanFood and beverage industry 100% 100%

Pra-operasiPre-operations 376.763.296 7.495.176.821

PT Sierad Corporation Jakarta

Distribusi dan perdagangan peralatan peternakan ayam,bahanbaku,pakanternakdan produk lainnyaDistribution and trading of poultryequipment,feedmillandotherproduct

100% 100%

Operasi dalam penghentianDiscontinued

operation

10.806.908.972 10.806.908.972

PT Transpasifik Niagareksa Jakarta

PerdaganganTrading 100% 100% 1995 6.249.425.538 6.840.481.539

PT Belfoods Indonesia Bogor

IndustripengolahanmakananbekuFrozen food processing industry

66,99% - 1993 138.292.784.706 -

6 Laporan Tahunan 2011 Sierad Produce

Vision MissionVisi Misi

72011 Annual Report Sierad Produce

visiMenjadi perusahaan pangan berbasis

unggas terintegrasi dan terkemuka di

Indonesia, yang mampu menciptakan

nilai-nilai berkesinambungan bagi para

pemegang saham dengan keunggulan yang

melampaui harapan para stakeholder.

To be the leading integrated poultry-based

food company in Indonesia that creates

sustainable shareholder value by exceeding

our stakeholders expectations with

exellence.

vision

misiKami berupaya untuk unggul dalam:

Menghasilkanprodukinovatifdanberkualitastinggi

bagi para konsumen.

Memberikanmanfaatkepadarekan-rekan

bisnis kami dengan proses produksi berskala

internasional.

Merekrut,mengembangkandanmemberikan

penghargaan kepada profesional berkualitas yang

berkarya dalam lingkungan kerja yang berprestasi

tinggi.

Secaraaktifmemberikankontribusiterhadap

kesejahteraan masyarakat sekitar.

We strive to excel in:

Deliveringhighquality,innovativeproductsfor

our consumers.

Creatingvalueacrossourworldclassprocesses

for our business partners.

Recruiting,developing,andrewardingfirst-class

professionals who thrive in a high-performance

work environment.

Activelycontributingtothewelfareofour

community.

mission

8 Laporan Tahunan 2011 Sierad Produce

92011 Annual Report Sierad Produce

Peristiwa PentingEvent Highlights

10 Laporan Tahunan 2011 Sierad Produce

Event HighlightsPeristiwa Penting

Penyelenggaraan RUPS Tahunan

Held an Annual General Meeting of Shareholders.

JuniJune

JuniJune

Penandatanganan perjanjian kredit dengan PT Bank Syariah Mandiri.

Signing a loan agreement with PT Bank Syariah Mandiri.

Penandatanganan perjanjian kredit dengan PT Bank Bukopin (Persero) Tbk.

Signing a loan agreement with PT Bank Bukopin (Persero), Tbk.

AprilApril

MaretMarch

Penandatanganan perjanjian kredit dengan PT Bank Mandiri (Persero) Tbk.

Signing a loan agreement withPT Bank Mandiri (Persero), Tbk.

MaretMarch

Pembukaan gerai ritel BelMart dan Delibel

Opening of BelMart and Delibel outlets.

Pembukaan beberapa gerai Kios Ayamku di Jabodetabek.

Opening of Kios Ayamku outlets in Jabodetabek.

JuliJuly

112011 Annual Report Sierad Produce

Pembukaan beberapa Kios Ayamku di Jabodetabek.

Opening of Kios Ayamku outlets in Jabodetabek.

NovemberNovember

Penyelenggaraan Tasyakuran atas proyek pembangunan Breeding Farm di Lebak, Banten.

Held a ceremony for Lebak Breeding Farm.

OktoberOctober

Penandatanganan perjanjian kredit dengan PT Bank Mandiri (Persero) Tbk.

Signing a loan agreement with PT Bank Mandiri (Persero), Tbk.

SeptemberSeptember

Sierad Produce tercatat sebagai salah satu dari 50 perusahaan dengan pertumbuhan tercepat versi majalah Fortune Indonesia.

Sierad Produce as one of 50 Indonesias Fastest Growing Companies 2011, Fortune Indonesia Magazines Version.

SeptemberSeptember

Penandatanganan perjanjian kredit dengan PT Bank Muamalat Indonesia Tbk.

Signing a loan agreement with PT Bank Muamalat Indonesia Tbk.

DesemberDecember

DesemberDecember

Akuisisi perusahaan pengolahan makananPT Belfoods Indonesia.

AcquisitionofPT Belfoods Indonesia, a food-processing company.

12 Laporan Tahunan 2011 Sierad Produce

132011 Annual Report Sierad Produce

Financial Highlights

Ikhtisar Keuangan

14 Laporan Tahunan 2011 Sierad Produce

Financial HighlightsIkhtisar Keuangan

KETERANGAN 2011 2010 2009 2008 2007 DESCRIPTION

Laporan Laba Rugi Statement of Income

PenjualanBersih RpMiliarIn Rp Billion 4.029 3.643 3.243 2.332 1.632 Net Sales

LabaKotor RpMiliarIn Rp Billion 422 351 231 216 159 GrossProfit

Laba(Rugi)Usaha RpMiliarIn Rp Billion 129 140 73 74 49 OperatingIncome(Loss)

Laba(Rugi)Bersih RpMiliarIn Rp Billion 22 61 37 27 21 NetIncome(Loss)

Laba(Rugi)Bersih/Saham

Rp/LembarRp/Share 2,35 6,51 3,96 2,90 2,26 EarningsPerShare

Neraca Balance Sheet

Aset Lancar RpMiliarIn Rp Billion 1.229 1.067 860 752 651 Current Asset

JumlahAset RpMiliarIn Rp Billion 2.642 2.037 1.641 1.385 1.295 Total Assets

KewajibanLancar RpMiliarIn Rp Billion 883 564 425 329 271 Current Liabilities

JumlahKewajiban RpMiliarIn Rp Billion 1.371 804 462 352 289 Total Liabilities

JumlahEkuitas RpMiliarIn Rp Billion 1.271 1.233 1.179 1.033 1.006 TotalStockholders

Equity

ModalKerjaBersih RpMiliarIn Rp Billion 347 503 434 423 380 Net Working Capital

Rasio Usaha (%) Operating Ratios (%)

MarjinLabaBersih % 0,55 1,68 1,15 1,17 1,30 NetProfitMargin

Rasio Keuangan (%) Financial Ratios (%)

Rasio Lancar % 139,28 189,18 202,10 228,38 240,58 Current Ratio

RasioHutangterhadapEkuitas % 107,82 65,25 39,24 34,04 28,71 DebttoEquityRatio

RasioTotalHutangterhadapTotalAset % 51,88 39,48 28,18 25,39 22,30

Total Liabilities to Total Assets Ratio

JumlahSahamBeredar LembarShare 9.391.108.493 9.391.108.493 9.391.108.493 9.391.108.493 9.391.108.493 NumberofShares

Outstanding

152011 Annual Report Sierad Produce

Total PenjualanDalam Miliar Rupiah

In Bilion Rupiah Net Sales

5.000

4.000

3.000

2.000

1.000

0

3.000

2.400

1.800

1.200

600

0

70

56

42

28

14

0

1.500

1.200

900

600

300

007

1.632

08

2.332

09

3.243

10

3.643

11

4.029

Total AsetDalam Miliar Rupiah

In Bilion Rupiah Total Assets

07

1.295

08

1.385

09

1.641

10

2.037

11

2.642

Total EkuitasDalam Miliar Rupiah

In Bilion Rupiah TotalStockholdersEquity

07

1.006

08

1.033

09

1.179

10

1.233

11

1.271

Laba (Rugi) BersihDalam Miliar Rupiah

In Bilion Rupiah Net Income (Loss)

07

21

08

27

09

37

10

61

11

22

16 Laporan Tahunan 2011 Sierad Produce

Stock PerformanceKinerja Saham

PEMEGANG SAHAM YANG MEMILIKI 5% ATAU LEBIH SAHAM

SHAREHOLDERS OWNING 5%OR MORE SHARES

Nama Pemilik SahamJumlah Saham

Number of SharesPersentase Percentage

Shareholders

Jade Field Assets Limited 1.461.657.441 15,56 Jade Field Assets Limited

HarvestAgentsLimited 1.345.766.034 14,33 HarvestAgentsLimited

KingdomIndustrialLimited 1.064.706.380 11,34 KingdomIndustrialLimited

KINERJA SAHAM STOCK PERFORMANCE

TahunYear

TriwulanQuarter

TertinggiHighest

(Rp)

TerendahLowest

(Rp)

PenutupanClosing

(Rp)

VolumeVolume(Unit)

JumlahTotal(Rp)

Jumlah Saham Tercatat

Total Share Listed

2011

I 76 50 60 2.597.283.348 154.907.307.370 9.391.108.493

II 72 55 67 3.653.551.958 234.723.616.470 9.391.108.493

III 92 55 61 7.419.570.348 561.660.948.870 9.391.108.493

IV 66 51 54 1.432.818.363 85.793.994.015 9.391.108.493

2010

I 52 50 50 786.981.500 39.294.179.000 9.391.108.493

II 56 50 50 2.443.422.000 125.843.555.000 9.391.108.493

III 58 50 53 3.196.934.600 172.328.010.300 9.391.108.493

IV 84 52 71 7.258.695.200 507.712.430.500 9.391.108.493

13.686.033.300 845.178.174.800

172011 Annual Report Sierad Produce

STRUKTUR PERMODALAN CAPITAL STRUCTURE

Keterangan Jumlah Saham

Number of Shares Nominal Nominal

Jumlah Nilai Nominal

Total NominalDescription

ModalDasar AuthorizedCapital

Seri A 73.099.900 395 28.874.460.500 A Series

Seri B 650.686.609 395 257.021.210.555 B Series

Seri C 35.561.973.000 100 3.556.197.300.000 C Series

Jumlah 36.285.759.509 3.842.092.971.055 Total

Modal Ditempatkan dan Disetor Penuh Subscribed and Fully Paid Capital

PT Sietek Nusantara Finance 20.018.500 395 7.907.307.500 PT Sierad Nusantara Finance

Masyarakat(sahamseriA) 53.081.400 395 20.967.153.000 Public(Aseries)

Masyarakat(sahamseriB) 650.686.609 395 257.021.210.555 Public(Bseries)

Masyarakat(sahamseriC) 8.667.321.984 100 866.732.198.400 Public(Cseries)

Jumlah 9.391.108.493 1.152.627.869.455 Total

18 Laporan Tahunan 2011 Sierad Produce

Kondisi makro ekonomi Indonesia yang kondusif di tahun 2011 ini turut mendukung perkembangan Sierad Produce.

Report from the Board of CommissionersLaporan Dewan Komisaris

Encouraging Indonesias macro economy conditions in 2011 had contributed to the development of Sierad Produce.

192011 Annual Report Sierad Produce

Antonius Joenoes SupitKomisaris Utama President Commissioner

20 Laporan Tahunan 2011 Sierad Produce

Dengan pendapatan perkapita yang tinggi, konsumsi protein hewani masyarakat Indonesia mengalamikenaikan yang signifikan pula. Sementara daging dan telur ayam yang merupakan sumber protein hewanipenting bagi manusia untuk tumbuh dan berkembangsertamenunjangproduktivitassehari-hariadalahprodukprotein hewani yang paling murah dibanding sumberproteinhewanilain,sehinggamenjadipilihanmasyarakatdiberbagailapisanbaikmenengahmaupunbawah.

Untuk memperpanjang rantai integrasinya sertamengusung semangat memperluas cakrawala bisnis,tahun 2011 Sierad Produce melakukan diversifikasiusahadenganmenambahliniusahadisisihilirnyayangbergerak di bidang makanan. Hal tersebut dilakukandenganmemperbanyakgeraiBelMartagardapat lebihmudah dijangkau oleh masyarakat dan mempermudahmasyarakatIndonesiamendapatkanmakananhalaldansehat,sertadenganmenyelesaikanakuisisiPerusahaanmakananjadiolahanPTBelfoodsIndonesia.Pemenuhankebutuhanproteinunggasyangberkualitasbaikadalahtujuanutamadarisegalausahakami.

DiversifikasiyangdilakukanolehSieradProducesemakinmeningkatkan kebutuhan akan sumber daya manusiayangberkualitas.Merupakansuatutantangantersendiribagi Direksi untuk mencari dan menempatkan SDMpadaposisiyangtepatsehinggadapatmendukunglajuperkembangan Perseroan.

KamipercayapencapaiankinerjaSieradProduceditahun2011 ini selain merupakan dampak dari kondisi ekonomi yangkondusif, jugamerupakanhasil kerjakerasbahu-membahuseluruhpihakyangtelahberkontribusi,mulai

WithhigherGrossDomesticProduct(GDP)percapita,the consumption of animal protein of Indonesiancommunity will increased significantly. Animal proteinis important for human growth and development aswellastosupportdailyproductivity.Whilethecheapestsources are chicken meat and eggs, so it becomes amiddleorlowerclasscommunityschoice.

To extend the chain of integration as well as to carrythe spirit of broadening the business horizon, in 2011Sierad Produce diversifies its business by adding its downstream business lines in the field of food. It isdonebymultiplyingBelMartoutletsinordertobemoreaccessible and to simplify Indonesian community to get halal and healthy food, as well as completed theacquisition of food company, PT Belfoods Indonesia.Theprimaryand fundamentalmissionofourbusinessremainsfirmlyplantedonsupplyinghighqualitychickenmeattosupplyproteinrequirement.

DiversificationbySieradProducewillincreasetheneedqualifiedhumanresources.ItisapleasurechallengefortheBoardofDirectorstofindandplacingHRattherightposition so that it can support the Companys rate ofdevelopment.

We believe the achievement of performance SieradProduce in 2011, in addition to considerable gains fromthefavorableeconomicconditions,wasalsotheoutcomeofhardworkhandinhandfromallcontributing

212011 Annual Report Sierad Produce

Sri Lestari AnwarKomisarisCommissioner

Antonius Joenoes SupitKomisaris Utama dan Komisaris IndependenPresident Commissioner and Independent Commissioner

Djohan EffendyKomisaris Independen

Independent Commissioner

22 Laporan Tahunan 2011 Sierad Produce

dari karyawan, Direksi dan manajemen senior, mitrabisnisdanseluruhstakeholderyangada.KamimelihatDireksi terus berupaya memperkuat kerja sama yangbaikdiseluruhliniPerusahaan,mengembangkanstrategi-strategi yang tepat untuk memajukan organisasi dankinerja operasional serta memelihara kesinambunganpengembangan kompetensi sumber daya manusia Perseroan.

Penegakan tata kelola perusahaan yang baik di dalamorganisasi maupun operasional perusahaan senantiasamenjadi prioritas utama Sierad Produce dalammenjalankanusaha.SesuaidenganketentuanBapepamserta untuk menjamin kelancaran dalam menunaikantugas dan tanggung jawabnya, Dewan KomisarisdibantuolehKomiteAudit,yangdiketuaiolehseorangKomisarisIndependen.KomiteAuditmempunyaitugasutamamendorongditetapkannyatatakelolaPerusahaanyang baik, terbentuknya struktur pengendalian internal yang memadai, meningkatkan kualitas keterbukaan danpelaporankeuangansertamengkaji ruang lingkup,ketepatan, kemandirian dan objektivitas auditoreksternal.

Dengan prediksi ekonomi Indonesia yang akan semakin membaikdanstrategipengembanganusahayangtepat,kami optimis bahwa ditahun 2012 mendatang kinerjaPerseroan dapat berkembang dan menjadi lebih baik.Perseroanakanmenciptakanpeluang-peluangbaruyangdapatmenunjangperkembangantersebut.

parties, our staffs, our Board of Directors and senior management, business partners and all stakeholders.We saw the Board of Directors persistent efforts inbuilding more solid cooperation across Company lines, developing perfect strategies to promote organizational andoperationalperformance,buildingcooperationwithstrategicpartners,andcontinuouslyimprovingitshumanresources.

Good Corporate Governance (GCG) practice inboth organization and operations remained as theSierad Produces top priority in doing business. In accordance with the provisions of Bapepam and forsmooth functioning of its duties and responsibilities,weareassistedbytheAuditCommittee,chairedbyanIndependent Commissioner. Primary function of TheAudit Committee is to encourage the implementationofGCG,toestablishadequateinternalcontrolstructure,improvethequalityofdisclosureandfinancialreporting,aswellastoreviewthescope,accuracy,independencyandobjectivityofexternalauditors.

With better Indonesias economic outlook and rightbusiness development strategy, we are optimisticthat in 2012, the Companys performance can growand perform better. The Company will create newopportunitieswhichcansupportthesedevelopments.

232011 Annual Report Sierad Produce

Dalam Rapat Umum Pemegang Saham Tahunan pada16 Juni 2011, Dewan Komisaris telah menyampaikanusulan pengunduran diri beberapa anggota Direksi yaitu BapakRodolfoPaguiaPantojadanBapakRoyAtmadjayangtelahdisetujuiolehparapemegangsahamdalamRUPS Tahunan tersebut. Sementara untuk susunanDewan Komisaris tidak mengalami perubahan. Kamiyakin bahwa susunan Dewan Komisaris dan Direksipada saat ini mampu memberikan kontribusi terbaik bagi Perseroan.

Sebagai penutup, atas nama Dewan Komisaris,perkenankanlah saya menyampaikan terima kasih atasdukungan dan kepercayaan yang diberikan oleh parapemegangsahamdanseluruhpemangkukepentinganSieradProduce.Kamijugamenyampaikanpenghargaanyangsetinggi-tingginyakepadaDireksidanmanajemen,serta seluruh karyawan yang telah berdedikasi danberupaya memberikan yang terbaik untuk kemajuanPerseroan.

In the Annual General Meeting Shareholders on June16,2011, theBoardofCommissionershas submittedresignation of several Board of Directors, Mr. RodolfoPaguiaPantojaandMrRoyAtmadjawhichisapprovedby theAGMS.While for theBoardofCommissionersdid not have change. The Company believes thatcurrent composition of the Board of Commissionersand Directors can give the best contribution to theCompany.

Finally,onbehalfoftheBoardofCommissioners,allowme to express my gratitude for the support and trustfrom our shareholders and stakeholders. We wouldliketoconveyourhighestappreciationtotheBoardofDirectors and management, and to all employees for theirbesteffortstosupporttheCompanysprogress.

Antonius Joenoes SupitKomisarisUtamadanKomisarisIndependen

President Commissioner and Independent Commissioner

24 Laporan Tahunan 2011 Sierad Produce

Report from the Board of DirectorsLaporan Direksi

Dengan ini kami menyampaikan bahwa Sierad Produce telah membukukan pencapaian yang baik di tahun 2011 ini dengan peningkatan penjualan hingga mencapai 10,61% jika dibandingkan dengan tahun 2010.

We hereby affirm that Sierad Produce has recorded a good achievement in 2011 with a sales increase to 10.61% compared to 2010.

Broadening The Horizon

252011 Annual Report Sierad Produce

Budiarjdo TekDirektur Utama President Director

26 Laporan Tahunan 2011 Sierad Produce

darikirikekanan|fromlefttoright

SudirmanDirekturDirector

Franciscus Xavarius Awi TantraDirekturDirector

Budiardjo TekDirektur UtamaPresident Director

Eko Putro SandjojoWakil Direktur UtamaDeputy President Director

Sik Wei TjienDirekturDirector

272011 Annual Report Sierad Produce

Pendapatan per kapita yang naik hingga mencapaiangka sekitar USD 3.500 di tahun 2011, memberikanpengaruh yang signifikan terhadap konsumsi proteinhewani masyarakat Indonesia. Karena ayam dan telurmerupakan sumber protein hewani yang termurah,maka jika tingkat ekonomi masyarakat meningkat dankebutuhandasarnyasudahterpenuhi,masyarakatakanmemilihuntukmeningkatkankonsumsiayamdantelurbagi keluarga. Pertumbuhan konsumsi ini mendukungupaya Sierad Produce mengembangkan bisnis dari segi kapasitas dan efisiensi produksi. Integrasi bisnis dari hulu ke hilir merupakan keunggulan utama SieradProduce serta memberikan kontribusi yang besar bagi pertumbuhanpenjualanPerseroanditahun2011.

Pembangunan fasilitas tambahanuntukkandangayaminduk tahap pertama di wilayah Lebak, Banten telahselesai, yakni terdiri dari 3 (tiga) farm dan beberapa diantaranya telah beroperasi diakhir tahun 2011.Pembangunan tahap kedua akan dilanjutkan di tahun2012, yakni dengan membangun tambahan 2 (dua)farm dan 1(satu) pabrik penetasan (hatchery). Adapunkeseluruhan daripada fasilitas tersebut di bangun diareaseluas250hektar.Pengoperasian fasilitasbarutersebut diharapkan dapat meningkatkan produksisekitar 30% di tahun-tahun mendatang dari produksisekarangyangsudahmencapai100jutaekorpertahunserta meningkatkan efisiensi produksi dan bio-security.

Kinerja 2011Sejak akhir tahun 2009, Sierad Produce memutuskanuntuk bersentuhan langsung dengan konsumen akhirdenganmendirikanBelMartsebagaisalahsatustrategiuntuk memasarkan produk-produknya. BelMart adalahgerai ritel modern yang menyediakan segala jenisdaging ayam, mulai daging ayam segar, ayam dibumbui, ayamolahan,maupunyangsiapdisantap,sertabahanmakanan penunjang lainnya. Dengan menjual ayamsegar, BelMart menjadi penyempurna rantai produksiPeseroandarihulukehilir.ProdukyangdijualdiBelMartterjaminkualitasnyakarenadiproduksidariRumahPotongAyam(RPA)milikPerseroansendiriyangmemenuhistandar ISO Internasional. Hingga akhir tahun 2011,Perseroan telahmemilikisejumlah45geraiBelMartdidaerahJabodetabek,yangmerupakanwilayahterdekatdariRPAyangtelahberoperasisaat ini,untukmenjagakualitas dari produk yang dihasilkan terutama dagingayam segar. Rangkaian proses produk yang ditempuh

GrossDomesticProduct(GDP)percapita increasedtoaroundUSD3,500inyear2011,bringsaboutsignificantinfluence to animal protein consumption of Indonesians. Sincechickenmeatandeggsarethecheapestsourceof protein, if peoples income improves and they canmeettheirbasicneeds,theywillchosetoincreasetheconsumptionofchickenandeggfortheirfamilies.Thisincreased consumption is conducive for efforts of Sierad Produce to develop its business in terms of production capacityandefficiency.End-to-endbusinessintegrationisthemainexcellenceofSieradProducecontributedtotheCompanyssalesgrowthin2011.

The construction of additional first phase of breedingfarm inLebak,Bantenwascompleted, itcomprised3(three) farms,someof themstarted tooperateat theendof2011.TheConstructionofsecondphasewillbestartedat2012,bybuilding2(two)additionalfarmsandahatchery.Asawholefacilityisbuiltinanareaof250hectares.Theoperatingofnewfacilitiesareexpectedtoincreaseproductionabout30%inthenearfuturefromthecurrentproductionthatreached100millionchickensperyearaswellasprovideproductionefficiencyandbio-security.

Performance of 2011Sincetheendof2009,SieradProducehasdecidedtomake a direct contact with end users by establishingBelMartasoneofstrategytomarketitsproducts.BelMartis a chain of modern retail outlet selling a variety ofchickenproducts,fromfreshtofrozenandreadytocookchickencomplementedwithsauces,flavors,spicesandothercooking ingredients,andconveniencegoods.Bysellingfreshchicken,BelMartaimestofurtherharnessthe economic benefits of its end-to-end integration.Products sold at BelMart stores give its consumerstheassuranceofsuperiorquality,worldclassstandardof live bird quality, slaughtering and handling becausetheyaregrownat theCompanysownedormanagedchickenfarmsandproducedattheCompanysownISOaccredited slaughterhouse. Until the end of 2011, theCompanyhasalreadyowned45BelMartoutletsinsomeareas of Jakarta, Bogor, Depok, Tangerang and Bekasi, because of the necessary link to slaughterhouses

28 Laporan Tahunan 2011 Sierad Produce

BelMart untuk menyediakan ayam bagi konsumen,telahmendapatsertifikasipenting,mulaisertifikathalalMUI, Shwali (lingkungan hidup) ISO 9001:200, danstandar keamanan pangan dari Hazard Analysis, Critical Control Points, (HACCP) dikenal sebagai sistem kontrol keamanan pangan internasional.

EkspansiBelMartditunjangolehketersediaanRPAyangdimilikiolehPerseroan.Saatini,RPAyangberoperasidiParungmemilikikapasitasmencapai100.000ekorhari.Perseroan membangun RPA baru di Mojokerto, JawaTimur, untuk mendukung ekspansi pasar dan rencana PerseroanuntukmembukageraiBelMartdisekitarareatersebut.PembangunanRPAdiMojokertotelahselesaidilaksanakan pada akhir tahun 2011 dan dapat mulaiberoperasiditahun2012.Beroperasinya rumahpotongayam yang berkapasitas 2.000 ekor per jam ini akanmeningkatkan kapasitas total produksi ayam potong Perseroan.

Padatahun2011,sebagaisaranamemperluascakrawalabisnisnya, Sierad Produce melakukan pengembangan usahayangdikelompokkanmenjadiduakategori,yakniDivisi Poultry dan Divisi Food yang masing-masingdipimpinolehseorangDirektur.DivisiPoultry merupakan bidang usaha yang secara khusus menangani usahapeternakanayamdanpakanternak.Padatahunini,DivisiPoultrytelahmelakukanintensifikasiuntukmeningkatkanproduktivitas. Strategi penjualan pada Divisi Poultry adalah dengan menekan biaya produksi serendah-rendahnya,melakukanrelationship marketing bersama-sama dengan peternak plasma. Sementara pada Divisi Foodyangmenghasilkanprodukkonsumen,PerseroanmelakukanintensifikasiusahadenganmenambahgeraiBelMartdengankonsepdansizeyanglebihefisiendanlebih dekat ke masyarakat. Perseroan juga melakukankerjasamadenganrumahmakandanritelbesaruntukmemasokprodukayamsegar.Selainitu,PerseroanjugatelahmenyelesaikanprosesakuisisiterhadapsahamPTBelfoodsIndonesiayangmemilikibidangusahaproduksimakananolahansepertichicken nuggets, sosis, bakso danlain-lain,sehinggadenganadanyaakuisisi inimakarantai integrasi Perseroan menjadi lebih panjang danlebihlengkap.

to maintain the high-quality of the stores productofferingsespeciallyitsfreshchickenproducts.AseriesofproductprocessdonebyBelMarttoprovidechickenfor customers is already got some certification, suchas, halal certificate from The Majelis Ulama Indonesia(MUI),Shwali(environmentalcertificate),ISO9001:200,andfoodsafetystandardfromHazardAnalysis,CriticalControlPoints(HACCP).Thelatestoneisknownastheinternational control system for food safety. The expansion of BelMart rests on the availability offresh chicken from the Companys slaughterhouse.NowadaysthecapacityoftheCompanysslaghterhousein Parung has 100,000 birds per day. In addition, theCompany built a new slaughterhouse in Mojokerto,East Java to expand the market at that area as wellas tosupport the rolloutofBelMart retailstores.Theconstructionfinished in theendof2011andwill starttooperatein2012.Theslaughterhousewithacapacityof2,000chickensperhourwillincreasetheCompanystotal production capacity.

In 2011, as a tools to broaden the business horizon,Sierad Produce has developed its businesses whicharecategorized in twodivision, that isPoultryDivisionand Food Division, each is led by a Director. PoultryDivisionisadivisionwhichisspecialtohandlefarmingand feedmill. This year, poultry division performedintensified efforts to increase productivity. Sales strategy ofpoultrydivisionistoreduceproductioncostaslowaspossibleanddoingrelationshipmarketingtogetherwiththe farmers. Meanwhile, for the food division whichproduces consumer goods, the Company has madeintensifiedeffortsbyopeningmoreBelMartoutletswitha more efficient concept and size and the outlets willbe opened closer to communities. The Company hasalsoestablishedcooperationwithrestaurantsandlargeretailers to supply fresh chicken products. In addition,the Company has also completed the process ofacquisitiontoPTBelfoodsIndonesiassharesthatownedprocessed food production, such as chicken nuggets,sausages, meatballs, and so on. With the acquisition,theCompanysintegratedchainhasbecomelongerandmore complete.

292011 Annual Report Sierad Produce

Meskipuntelahterdapatpeningkatanpenjualan,namun lababersihpersahamturundariRp6,51ditahun2010 menjadiRp2,35ditahun2011yangterutamadisebabkanoleh meningkatnya beban usaha serta beban bungaakibat dari ekspansi usaha yang dilakukan Perseroan,yang diantaranya berupa investasi beberapa fasilitas baru yangmasihtahappembangunandanbelummemberikankontribusiterhadappendapatanPerseroan.

Tata Kelola PerusahaanKomitmen terhadap Good Corporate Govermance (GCG) telah menjadi budaya yang mengiringi setiaplangkahbisnisPerseroan.SalahsatubentukkesungguhanSieradProducedalamhaliniadalahdenganmelakukanevaluasiatasefektivitaspenerapanGCGsecarateratur.Berdasarkan hasil evaluasi yang diberikan, DewanKomisaris dan Direksi mengambil langkah-langkahpenyempurnaanpelaksanaanGCG.

Sumber Daya ManusiaKaryawan adalah sumber daya utama yang menggerakkan seluruh sumber daya Perseroanlainnya. Kualitas sumber daya manusia yang baikakan dapat menentukan arah perkembanganperusahaan di kemudian hari. Dengan starategi bisnisekspansi kapasitas dan operasi, tuntutan untuk terus meningkatkan kualitas sumber daya manusia makin tinggi.Berbagailangkahdanstrategitelahkamilakukanuntuk menjamin ketersediaan sumber daya manusiayang handal dan berdedikasi tinggi. Di tahun 2011 ini,Perseroan melakukan perekrutan melalui program Management Trainee terhadap sarjana-sarjana barusebagai usaha memperoleh orang-orang terbaik untukregenerasidiPerseroan.Selainitu,Perseroanjugatelahmerekrutorang-orangyangberkompetensitinggiuntukmenggerakkanlini-linibisnisyangsedangdikembangkan.Perseroan juga telah menyelenggarakan berbagaipelatihan dan pengembangan sumber daya manusiauntuk meningkatkan kompetensi karyawan dalambisnis yang terintegrasi. Selain itu, sistem monitoring juga diterapkan untuk mengawasi perkembangan danmenjamin keberhasilan dari program yang sedangdijalankan.

Tanggung Jawab SosialSebagai sebuah perusahaan publik, Sierad Producemenyadari pentingnya suatu interaksi sosial dengan warga masyarakat yang berada di sekitar area kerjaPerseroan. Sierad Produce melakukan usaha-usahauntukmensejahterakanmasyarakat.FokusprogramCSRtahun2011adalahpeningkatankualitashiduplingkungan

Whilethereisanincreasingofnetsales,meanwhilethenetprofitofpersharedecreasedfromRp6.51in2010toRp2.35in2011causedbytheincreaseinoperatingandinterestexpensesduetotheCompanysbusinessexpansion,includingtheinvestmentofnewproductionfacilities which is still on construction progress whichhasnotcontributedtotheCompanysrevenueyet.

Good Corporate GovernanceCommitment to the Good Corporate Governance(GCG) has become a culture that sides with eachand every step of the Companys businesses. SieradProduce do the evaluation regularly to ensure theeffective implementationofGCG.Basedon the resultof such evaluation, the Board of Commissioners andBoard of Directors can take necessary actions in order tocompletetheGCGimplementation.

Human ResourcesEmployeesserveastheenginethatfuelstheCompanysadvances.Consequently,thequalityofhumanresourcesdetermines the Companys future, as a businessenterprise. The excellent human resource quality willbe able to determine the Companys progress in thefuture.Withthebusinessstrategiestoexpandcapacityandoperation,thedemandtoimprovehumanresourcesisgettinghigher.Variousmeasuresandstrategieshavebeendonetoensuretheavailabilityofreliableandhighly-dedicated human resources. In 2011, the CompanycarriedoutrecruitmentthroughaManagementTraineeprogram for new university graduates as an effortto get the best human resources for the Companysregeneration. Besides, the Company has recruitedhuman resources with excellent competency to drivethe lines of business being developed. The Companyhas also carried out human resource trainings anddevelopment to improve the employees competencyin the integrated business. Beside that, a monitoringsystem also be implemented to monitor progress and ensurethesuccessoftheprogrambeingexecuted.

Social ResponsibilityAsoneofthepubliclylistedcompany,SieradProduce,realizing the need of the social interaction with thecommunity around its business units. Sierad Produce vigorously pursues a variety of social programs and activities to bring welfare to the communities. ThefocusofCSRprogramin2011wastheimprovementof

30 Laporan Tahunan 2011 Sierad Produce

sekitar. Secara kontinyu kami telah menyelenggarakanserangkaian program yang berhubungan dengankesehatan dan sanitasi, serta menyediakan telur dandaging ayam untuk diberikan kepada masyarakat yang kurangberuntungdisekitarlingkunganperusahaan.

Prospek 2012Di tahun 2012 mendatang, selain terus menambahkapasitas produksi, Perseroan juga akan melakukanekspansi operasi dengan memperluas cakupan daerahoperasional ke luar pulau seperti Sulawesi, Bali,Kalimantan, dan Sumatera. Dengan konsumsi dagingayam yang baru mencapai 7 kg per kapita per tahundimana angka ini jauh dibawah rata-rata konsumsinegara Asia Tenggara lainnya seperti Malaysia danSingapura yang berada pada level di atas 30 kg per kapita*, dan jumlah pendapatan per kapita yang akansemakinmeningkat,Perseroanoptimisbahwa industriperunggasan Indonesia memiliki prospek yang sangat menjanjikan dan berharap dapat mengambil bagianuntuk mengisi potensi besar tersebut. Strategi yang dilakukanadalahdenganmelanjutkanstrategiyangtelahdilakukan ditahun-tahun sebelumnya serta melakukanpeningkatan produksi untuk mencapai visi Perseroan yakni menjadi perusahaan pangan berbasis unggasterintegrasi dan terkemuka di Indonesia, yang mampu menciptakan nilai-nilai berkesinambungan bagi parapemegangsahamdengankeunggulanyangmelampauiharapanparastakeholder.

theneighbourhoodquality.Wecontinuallyhaspursueda seriesof health and sanitationprograms, aswell asprovidedeggsandchickenmeat to the less fortunatemembers of society and supported innovations that will benefit neighbouring communities and theenvironment.

Prospect of 2012 Intheupcoming2012,apartfromincreasingproductioncapacity, the Company will also perform operationalexpansion by expanding the scope of the regionaloperations to outside of Java, such as Sulawesi, Bali,Kalimantan, and Sumatera. With the consumption ofchicken is only 7 kg per capita per annum, which isbelowtheaverage inotherSoutheastAsiancountries,suchasMalaysiaandSingapore,reachingtoabove30kgpercapita*,aswellastheincreasinginGDPpercapita,the Company feels optimistic that poultry industry inIndonesia has a promising prospect and expects tobe able to fulfil the great potential. Strategy taken isto continue the strategy that has been done duringthose previous years and increased its production toachievetheCompanysvisionofbecomingtheleadingintegratedpoultry-basedfoodcompanyinIndonesiathatcreatessustainableshareholdervaluebyexceedingourstakeholdersexpectationswithexcellence.

*)Sumber:FAO *)Source:FAO

312011 Annual Report Sierad Produce

Perubahan Komposisi DireksiDalam RUPS Tahunan pada 16 Juni 2011, DewanKomisaris telah mengusulkan pengunduran beberapaanggota Direksi yaitu Bapak Rodolfo Paguia PantojadanBapakRoyAtmadjayang telahdisetujuiolehparapemegangsahamdalamRUPSTahunantersebut.

ApresiasiPerseroanmengucapkanterimakasihsebesar-besarnyakepadasemuapihakyangtelahmendedikasikanwaktudan tenaganya demi kemajuan bersama. Perseroanjugabersyukur atasdukungandanantusiasmeDewanKomisaris Perseroan, dan atas kepercayaan, kesetiaandan dukungan para konsumen, mitra dagang, Bank dan pemegang saham. Kepada mereka semua, Perseroanmemberikan penghargaan sedalam-dalamnya danberkomitmen bersama-sama seluruh stakeholder untukmembawaPerseroantumbuhmakinpesatlagidikemudianhari.

Change of Board of Directors CompositionIn the Annual General Meeting Shareholders (AGMS)on June 16, 2011, the Board of Commissioners hassubmittedresignationofseveralBoardofDirectors,Mr.Rodolfo Paguia Pantoja and Mr Roy Atmadja which isapprovedbytheAGMS.

AppreciationTheCompanywouldliketoexpressutmostgratitudetoallpartieswhohavededicatedtheirtimeandeffortsforourcommonprogress.TheCompanyisalsogratefulforthesupportandenthusiasmoftheCompanysBoardofCommissioners,andisgratefulforthetrusts,loyalty,andsupport given by the customers, partners, banks, andshareholders. To all of them, the Company expressedutmost appreciation and with all stakeholders, theCompany iscommittedtobringtheCompanytogrowevenfasterinthefuture.

Budiardjo TekDirekturUtama

President Director

32 Laporan Tahunan 2011 Sierad Produce

332011 Annual Report Sierad Produce

Sumber Daya ManusiaHuman Resources

34 Laporan Tahunan 2011 Sierad Produce

Sumber Daya ManusiaHuman Resources

352011 Annual Report Sierad Produce

SumberDayaManusia(SDM)merupakansalahsatuaset terbesar yang dimiliki oleh PT Sierad Produce,Tbk yang merupakan perusahaan berbasis kinerja.Oleh karena itu peningkatan kompetensi, efektivitaskerja dan kapabilitas SDM selalu menjadi perhatianPerseroan. Selain itu, sebagai ujung tombak, SDMdiharapkanmampumenjunjungtingginilai-nilaiintiagarvisiuntukmenjadiperusahaanpanganberbasisunggasterintegrasi dan terkemuka di Indonesia dapat tercapai. SDM yang berkualitas dapat menjadi mitra terpercayayangsenantiasamemberinilaitambahbagiPerseroan.Hal-hal inilah yang membuat pihak manajemen selalumenempatkan pengembangan kualitas SDM sebagaiprioritas yang utama.

Sierad Produce selalu berkomitmen untuk memberikan produk yang inovatif dan berkualitas baik dengan harga yang terjangkau serta memaksimalkan segalasumber daya yang tersedia. Strategi Perusahaanuntuk memperluas horizon perusahaan membutuhkanpengembangan organisasi dan kinerja karyawan.Diperlukan suatu sistem pengembangan sumber daya manusia yang fleksibel dan optimal agar selaras dengan dinamika bisnis perusahaan. Pada tahun 2011, SieradProducetetapkonsistenmenjalankanprogram-programpengembangan sumber daya manusia, antara lain:

Asaperformance-basedCompany,HumanResources(HR)isoneofthelargestassetsownedbyPTSieradProduce Tbk. Therefore, the Company always give anattention to improvement of competence, workingeffectiveness and HR capabilities. In addition, as aspearhead,HRisexpectedtoupholdingthecorevaluessothevisiontobetheleadingintegratedpoultry-basedfoodcompany in Indonesiacanbeachieved.QualifiedHRcanbeareliablepartnerthatisalwaysgivingaddedvaluetotheCompany.ThesethingsmakemanagementalwaysputthedevelopmentofHRqualityasapriority.

Sierad Produce always committed to delivered highqualityandinnovativeproductswithaffordablepricesaswellasmaximizingallavailableresources.TheCompanystrategytobroadeningthehorizonneedsdevelopmentof the organization and employees performance. Aflexible and optimal human resource developmentsystemisnecessaryinordertoalignwiththedynamicsof the Companys business. In 2011, Sierad Produceconsistently applies human resources developmentprograms,suchas:

36 Laporan Tahunan 2011 Sierad Produce

Menyiapkankaderisasiuntukpemimpinmasadepanmelalui program Management Trainee dengan kandidat dari lulusan perguran tinggi ternama di Indonesia. Peserta Management Trainee tahun initidakdibatasihanyadarifakultasPeternakansaja.

Menyiapkan kaderisasi untuk tenaga ahli teknikdi masa depan melalui program Technical Trainee dengan merekrut lulusan Teknik di perguran tinggi negeri ternama di Indonesia.

Menyiapkan kandidat internal untuk mengisikekosongan posisi melalui program Sierad Continues Program Development(SCPD).

Mengimplementasikan program Health Safety Enviroment (HSE),secarabertahapdiseluruhUnit.

Selain itu, selama tahun 2011 ini kami juga tetapmenerapkan Balance Score Card (BSC) dan GugusKendali Mutu (QCC) pada masing-masing divisi diSierad Produce. Implementasi BSC diawali denganmelakukanpelatihansecarabertahapyangdimulaidaritingkat manajemen sampai ke tingkat kepala divisi,yang kemudian dilanjutkan dengan menetapkan targetperusahaan serta strategi yang akan di jalankan untukmencapaitargettersebut.Selanjutnyauntukmengatasiadanya jarak target terhadap strategi yang telahditetapkan, Perseroan memfasilitasi karyawan denganmembuat inisiatif-inisiatifproject pada tingkat operator

PreparingtheregenerationoftheCompanysfutureleader through Management Trainee programwith candidates from Indonesias most respecteduniversities. Management Trainee participants thisyear are not limited only from farming faculty.

PreparingtheregenerationoffuturetechnicalexpertsthroughtheprogramofTechnicalTraineebyrecruitinggraduates of engineering from Indonesias most respected universities.

Preparing internal candidate fulfil theposts throughSierad Continues Program Development (SCPD)programs.

Gradually implementing Health Safety Environment(HSE)programthroughouttheunits.

In addition, we also applying Balance Score Card(BSC) and Quality Control Circle (QCC) during theyear of 2011 in all divisions in Sierad Produce. TheimplementationofBSCinitiatedbystep-by-steptrainingfrommanagementtotheheadofdivision,followedbysetting the companys target and strategy to achievethetarget.Furthermore,toovercomethegaptargetofthestrategysetby,theCompanyfacilitatedemployeestomakeprojectinitiativesattheoperatorlevelthroughgroup activity called Quality Control Circle (QCC) asan effort to improved performance working systems,both individuals and groups. Initiatives undertaken at

372011 Annual Report Sierad Produce

the QCC including quality, cost, delivery, and safety.Currently, BSC implementation throughout the unitshavealmost reached80%.As for theQCCalignwiththeBSCprogram.

Commitment from Sierad Produce to improve employees competency is reflected by the number of employeetraining and development program conducted in 2011. TheCompanyspentmorethanRp1.9billiontodevelopemployeecompetencies.Thetypeoftrainingdiversified;rangingfromtechnicalskillrelatedtotheproduction,sales,marketing,tax,etc.tothesoftskilledworkers,suchasthecommunicationsleadership,openthinkingetc.WhileManagementTraineeprogram(MT)heldtofind companys future leaders.

Sierad Produce support to the education in Indonesiaisshownthroughawardingscholarshipstooutstandingstudent and giving the opportunities for studentinternship as well as research related to industry tostudents and lecturers.

melaluiaktivitasgroupyangdisebutQCCsebagaiusahaperbaikan kinerja dan sistem kerja, baik peroranganmaupunkelompok.Inisiatif-inisiatifyangdilakukanpadaQCCmeliputikualitas,biaya,delivery dan keselamatan. SaatinipengimplementasianBSCdiseluruhunitbisnissudah hampir mencapai 80%. Sedangkan untuk QCCberjalanselarasdenganprogramBSC.

Komitmen Sierad Produce untuk meningkatkankompetensikaryawantercermindaribanyaknyaprogrampelatihandanpengembangankaryawanyangdilakukanpadatahun2011.Perusahaanmengeluarkanbiayalebihdari Rp 1,9 miliar untuk pengembangan kompetensi karyawan. Jenis pelatihan beragam, mulai dari yangsifatnya technical skill yang berkaitan dengan produksi, sales, marketing, tax dan lain-lain, sampai kepadasoft skill seperti komunikasi, leadership, open thinking dan lain-lain.SementaraProgramManagement Trainee(MT)diadakanuntukmencaricalonpemimpinperusahaandimasa depan.

Dukungan Sierad Produce terhadap kemajuan duniapendidikandi Indonesiaditunjukkanmelaluipemberianbeasiswa kepada mahasiswa berprestasi sertamembukan kesempatan magang kepada mahasiswasertapenelitian-penelitianyangberkaitandenganindustriterbukauntukmahasiswadandosen.

38 Laporan Tahunan 2011 Sierad Produce

Padatahun2012mendatang,DivisiSDMSieradProducemempunyai rencana sebagai berikut: Menilai dan mengembangkan penilaian kompetensi

serta mengimplementasikannya pada tingkat manajemenkeatas.Penilaiankompetensiyangbaikdiharapkan dapat mendeteksi kompetensi khususkaryawanagarPerseroanbisamempersiapkankader-kader kepemimpinan masa depan serta mengisi posisi-posisiyangkosongpadalevelmanajerial.

Meningkatkan pelaksanaan performance management agar indikator kinerja dan target padasetiapposisimenjadilebihterarah.

Memberdayakan para pimpinan untuk melakukancoahing dan counselingsehinggasetiapbawahannyadapat mencapai target yang telah tetapkan perusahaan, serta dapat menentukan arahpengembanganyangtepatbagianakbuahnya.

Mengembangkan dan mengintegrasikan Human Resources Management System (HRIS) yang ada disetiap unit agar pengelolaan dan pengembangan

Inthenextyearof2012,SieradProduceHRDivisionhasseveralplans,suchas: To assess and develop as well as implement

competency assessment at the management andabovelevel.Agoodassessmentexpectedtodetectthe specific competencies of employees in orderto give the opportunity to the Company to prepareregenerationof future leadershipandfill thevacantpositions at managerial level.

To improve the implementation of performancemanagement so the indicators and target of eachposition can be more focused.

Toempowertheleaderstodocoachandcounsellingsoeachemployeecan reach target thathavebeensetbytheCompanyanddeterminetherightdirectionof employee development.

TodevelopandintegrateexistingHumanResourcesManagementSystem(HRIS)ineachunitinordertomake management and development of employee careerrightontarget.HRISdevelopmentisalsothe

392011 Annual Report Sierad Produce

karir karyawan menjadi lebih tepat sasaran.PengembanganHRIS jugasebagaiupayaPerseroandalam meningkatkan pelayanan terhadap karyawandenganpengelolaanadministrasikepegawaianyanglebihefisien.

MelakukanpenilaianulangsertamenyusunprogramCompensation and Benefit agar selaras dengan pengembanganperusahaan.

Companys efforts to increase services to employees by more efficient management of personnel administration.

Tore-assessanddevelopCompensationandBenefitprogramsinalignwiththecompanysdevelopment.

40 Laporan Tahunan 2011 Sierad Produce

412011 Annual Report Sierad Produce

Tata KelolaPerusahaanCorporate Governance

42 Laporan Tahunan 2011 Sierad Produce

Tata KelolaPerusahaanCorporate Governance

432011 Annual Report Sierad Produce

Latar BelakangTataKelolaPerusahaanmerupakanprosesdanstrukturyangmengaturpengelolaanperusahaandengantujuanmewujudkanpengelolaanperusahaansecaraprofesional,menciptakan proses pengambilan keputusan yang didasarkanpadanilaimoral yang tinggidankepatuhanterhadapperaturanperundang-undanganyangberlaku,serta membangun kesadaran tiap organ perusahaandalam menjalankan fungsi dan perannya. Perusahaanyang ingin memberikan nilai tambah bagi pemangkukepentingan dan mempertahankan keunggulan dalammenghadapipersainganharusmenerapkanTataKelolaPerusahaan yang baik (Good Corporate Governance/GCG) secara konsisten dan konsekuen sertamenjadikannya sebagai budaya kerja yang berlaku didalamperusahaan.PemahamaninimendasarikomitmenSieradProducesebagaisebuahperusahaanpublikuntuksenantiasa menegakkan penerapan GCG dalam setiapjenjangorganisasidankegiatanoperasionalnya.

BackgroundCorporate Governance is a process and structurewhich is essential to oversee the management thataims at operating a company professionally, creating a decision-making process based on high moral valuesand compliance to the prevailing laws and regulationsas well as to raise awareness of each organs withinthe organization in conducting its functions and roles.Companies that want to provide added value for itsstakeholders and maintain its competitive advantagein facing the competition must apply the principles ofGood Corporate Governance (GCG) consistentlyandconsequentlyaswellastotrytopracticeGCGaspart of a corporate culture within the company. ThisunderstandingunderliestheCompanyscommitmenttoalwaysupholdGCGimplementationateveryleveloftheorganization and its operations activities.

44 Laporan Tahunan 2011 Sierad Produce

PENDEKATAN TATA KELOLA PERUSAHAAN

Prinsip-prinsip kewajaran (fairness), transparansi(transparency),akuntabilitas(accountability)dantanggungjawab (responsibility) merupakan aspek yang harusditerapkan dalam setiap kegiatan bisnis agar manfaat yangoptimalbagiseluruhpemangkukepentingandapatdicapai.PerusahaanjugaterusberupayamenumbuhkanpenerapankodeetikdanprinsipGCGsebagainilaidanbudaya yang melekat di kalangan karyawan SieradProduce.

Kewajaran dan KesetaraanKepentingan pemegang saham dan pemangkukepentingan lainnya selalu mendapatkan perhatiankhususdariPerseroan.Perseroanjugaselalumenerapkanperlakuan yang setara baik kepada publik, otoritas pasar modal, komunitas pasar modal, maupun para pemangku kepentingan.Sementaraituhubungandengankaryawandijaga dengan memperhatikan hak dan kewajibannyasecaraadildanwajar.

TransparansiAsas keterbukaan selalu diterapkan oleh SieradProduce dalam menjalankan bisnisnya melaluipenyediaan informasi yang material dan relevan serta dengan cara yang mudah diakses dan dipahami olehpemangkukepentingan. Informasiyangseluas-luasnyadiberikankepadapublikdanpemegangsaham,denganmemperhatikan peraturan Bapepam-LK maupun atasinisiatif sendiri. Laporan-laporan diterbitkan secaraberkala dan tepat waktu, yang mencakup LaporanKeuangan Triwulan, Laporan Keuangan Semester, danLaporanKeuanganTahunanyangdiaudit,sertaLaporanTahunan.Informasijugadiberikanmelaluipaparanpublik,media cetak dan elektronik, serta forum investor.

AkuntabilitasSieradProducememilikisistempengelolaanperusahaanyang mendukung terciptanya kejelasan fungsi,pelaksanaan dan pertanggungjawaban kinerja organperusahaan. Prinsip akuntabilitas diterapkan antaralain melalui langkah-langkah pelaporan Direksi kepadaDewanKomisarismengenairencanaanggarantahunandanevaluasibersamaataskinerjakeuanganPerseroan,penyampaian laporan keuangan pada RUPS Tahunan,pembentukan Audit Internal serta penunjukan auditoreksternal.

PertanggungjawabanUntuk menjaga kesinambungan usaha dalam jangkapanjang dan mendapatkan pengakuan sebagai wargakorporasi yang baik, maka Sierad Produce senantiasa menjunjung tinggi kepatuhan terhadap peraturan

APPROACH TO CORPORATE GOvERNANCE

Fairness, transparency, accountability and responsibility aretheaspectsthatshouldbeappliedinanybusinessactivity in order to achieved optimists benefits for allstakeholders. The Company continually develop theapplicationofcodesofethicsandprinciplesofGCGasanattachedvaluesandcultureamongstSieradProduceemployees.

FairnessandEqualityThe interests of shareholders and stakeholdersconstantly acquirespecial attention inSieradProduce.TheCompanyguaranteesequaltreatmenttothepublic,capital market authorities, capital market communitiesandstakeholders.Meanwhile,relationswithemployeesaremaintainedwith respect to the realizationofequalandfairrightsandresponsibilities.

TransparencyThe principle of transparency and continuouslymaintaining objectivity are constantly implementedby Sierad Produce in conducting its business throughreleasing substantive and relevant information that iseasily accessible and understood by stakeholders. Allinformationispublishedtothepublicandshareholders,both incompliancewiththeBapepam-LKsregulationsand on its own initiative. Bilingual reports (Englishand Indonesian) arepublishedon a periodic basis andin a timely manner, consisting of quarterly financialstatements,firsthalffinancialstatements,andauditedfinancial statements, as well as annual reports.Information is also presented through public expose,print and electronic media, and investor forums.

AccountabilitySieradProducehasinplacedacorporatemanagementsystem that supports clarity in the function,implementation and responsibility of units within thecorporate structure. Measures initiated to uphold theprincipleofaccountabilityamongothers,aretheBoardofDirectors reporting to theBoardofCommissionerson the annual budget plan and joint evaluation of theCompanys financial performance; submission of financial statementstotheAGMS,establishmentofan internalaudit,andtheappointmentofanexternalauditor.

ResponsibilityTomaintainbusinesscontinuityinthelongrunandtogainrecognition as a good corporate citizen, the Companyuncompromisingly places priority on adherence tothe existing laws and regulations, and in fulfilling its

452011 Annual Report Sierad Produce

perundang-undangan serta melaksanakan tanggungjawab terhadap masyarakat dan lingkungan. Dengansenantiasa melakukan program-program Corporate Social Responsibility (CSR) yang mencakup aspek pendidikan, sosial dan lingkungan, Sierad Produce terlibat langsung dalam berbagai kegiatan sosial yang difokuskan pada pengembangan masyarakat yang beradadilingkunganperusahaan.

Kepatuhan terhadap Ketentuan dan Peraturan Pasar ModalSieradProducesebagaiperusahaanpublikyangterdaftardi Bursa Efek Indonesia senantiasa patuh terhadapUndang-Undang Perseroan Terbatas Indonesia sertaberbagai peraturan dan ketentuan pasar modal dan bursalainnyayangrelevan.Melaluikepatuhanterhadapundang-undangdanperaturanyangberlaku,Perseroanakan lebih meningkatkan praktik GCG diseluruh aspekoperasionalnya.

Transaksi Berbenturan KepentinganPadatahun2011,Perusahaantidakmelakukantransaksiyang mengandung benturan kepentingan, sebagaimana yang ditetapkan dalam ketentuan Peraturan Bapepam danLKNo.IX.E.1,LampiranKeputusanKetuaBapepamdan LK No.Kep-412/BL/2009 tanggal 25 November2009. Transaksi MaterialPadatahun2011,Perusahaantidakmelakukantransaksimaterial, sebagaimana ketentuan Peraturan Bapepam danLKNo.IX.E.2,LampiranKeputusanKetuaBapepamdanLKNomor:Kep-614/BL/2011tanggal28November2011.

Perkara Penting yang DihadapiHinggatanggalLaporanTahunan,tidakterdapatperkarahukum yang dihadapi oleh Perseroan, Direksi maupunDewan Komisaris Perseroan yang memiliki dampakmaterialterhadapkegiatanusahaPerseroan.

Struktur Pengelolaan PerusahaanStruktur Tata Kelola Perusahaan Sierad Producemengacu kepada undang-undang perusahaan yangberlaku di Indonesia. Strruktur tersebut terdiri dari Rapat UmumPemegangSaham(RUPS),DewanKomisarisdan Direksi.

Rapat Umum Pemegang SahamRUPS merupakan organ tertinggi di Sierad Produceyangmemegangseluruhwewenangdi luaryangtelahdidelegasikankepadaKomisarisataupunDireksi.Untukmemberikan perlindungan kepada kepentingan para pemegang saham, Perseroan memastikan bahwaRUPST diselenggarakan tepat pada waktunya dan

responsibility to the community and the environment,hencesustaininglong-termbusinesscontinuity.Throughan integrated Corporate Social Responsibility (CSR)program,theCompanyisdirectlyengagedinahostofsocial endeavour focused on community development, whichincludeseducation,social,andenvironment.

.

Compliance to Rules and Regulation of Capital Market and Stock ExchangeAsapublic-listedcompanyregisteredintheIndonesianStock Exchange, the Company always adheres to theIndonesian Law on Limited Liabilities Company andCompany and to rules and regulations of the capitalmarketaswellastootherrelevantregulations.Complyingto the prevailing law and regulations, the CompanypledgestoimproveGCGpracticesinalloperations

Conflict of Interest TransactionsThroughout 2011, the Company did not conductany conflict of interest transaction, as defined under the provision of Bapepam-LK Regulation No.IX.E.1,Attachment of Bapepam-LK Chairman No.Kep-412/BL/2009dated25November2009.

Material TransactionsThroughout 2011, the Company did not conduct anymaterial transactions, as defined under the provisionofBapepam-LKNo.IX.E.2,AttachmentofBapepam-LKChairman No. Kep-614/BL/2011 dated 28 November2011.

Litigation and Important CaseUptothedateoftheAnnualReport,therearenolegalcases facedby theCompany,or itsDirector,BoardofCommissioners having a material effect on businessactivities.

Corporate Governance StructureSierad Produces Governance Structure refers to thecorporate laws in Indonesia. Itconsistsof theGeneralMeeting of Shareholders (GMS), the Board ofCommissionersandtheBoardofDirectors.

General Meeting of ShareholdersGMSrepresentsacorporateorganwiththehighestpowerand authority. To protect the interest of shareholders,Sierad Produced ensured that the Annual GeneralMeeting Shareholders Meeting was held according toscheduleaswellaspreparedaccordingtotheCompanysArticle Association and Capital Market and Financial

46 Laporan Tahunan 2011 Sierad Produce

dipersiapkan sesuai dengan ketentuan Anggaran Dasar Perseroan dan Peraturan Bapepam-LK Nomor IX.I.1.Selama tahun2011SieradProduce telahmengadakan1 (satu) kali RUPST yakni pada tanggal 16 Juni 2011.RUPSTtersebutdihadirioleh5.050.399.769(limamiliarlima puluh juta tiga ratus sembilan puluh sembilanribu tujuh ratus enam puluh sembilan) atau 53,78%(limapuluhtigakomatujuhpuluhdelapanpersen)dari9.391.108.493(sembilanmiliartigaratussembilanpuluhsatu juta seratus delapan ribu empat ratus sembilanpuluhtiga)saham,yangmerupakanseluruhsahamyangtelah dikeluarkan Perseroan. Keputusan RUPST yangtelah dilaporkan dan diumumkan melalui surat kabaradalah:1. Menerima baik Laporan Direksi mengenai usaha

Perseroanselamatahunbuku2010(duaribusepuluh)sertapengesahanPerhitunganTahunanyangmeliputiNeracadanPerhitunganLabaRugiPerseroanuntuktahunbukuyangberakhirpadatanggaltigapuluhsatuDesemberduaribusepuluh(31-12-2010),yangtelahdiauditolehKantorAkuntanPublikTanubrataSutantoFahmi&Rekan.

2. PenggunaanlababersihPerseroantahunbukuyangberakhirpadatanggaltigapuluhsatuDesemberduaribusepuluh(31-12-2010)sebagaiberikut:(a) sebesar Rp 9.391.108.493,00 (sembilan miliar

tiga ratus sembilan puluh satu juta seratusdelapan ribu empat ratus sembilan puluh tigaRupiah) atau sebesar 15,4% (lima belas komaempat persen) dari laba bersih Perseroantahun buku 2010 (dua ribu sepuluh), dibagikansebagai dividen tunai kepada para pemegang saham Perseroan sehingga setiap saham akanmemperolehdividentunaisebesarRp1,00(satuRupiah);

(b) sebesar Rp 3.057.415.309,00 (tiga miliar limapuluh tujuh juta empat ratus lima belas ributiga ratus sembilan Rupiah) dialokasikan dandibukukan sebagai dana cadangan;

(c) sisanya dibukukan sebagai laba ditahan yangakan digunakan untuk menambah modal kerjaPerseroan; termasuk memberikan kuasa dan wewenang kepada Direksi Perseroan untukmelakukan setiap dan semua tindakan yang diperlukan sehubungan dengan keputusantersebut diatas, sesuai dengan peraturan perundang-undanganyangberlaku.

InstitutionSupervisoryAgency(Bapepam-LK)RegulationNo. IX.I.1. In 2011, Sierad Produce conducted AnnualGeneralShareholdersMeetingonJune,16,2011.TheAGMSwasattendedby5,050,399,769(fivebillionfiftymillion threehundredninetynine thousandandsevenhundredsixtynine)or53,78%(fiftythreepointseventyeight percent) from 9,391,108,493 (nine billion threehundredninetyonemilliononehundredeightthousandand fourhundredninety three)ofall shares issuedbytheCompany.TheresultoftheAGMSwas:

1. Approval of the report from the Board of Directorsregarding the Companys activities during the year2010andtheBalanceSheetandIncomeStatementended thirty first December two thousand and ten(31-12-2010) which has been audited by the PublicAccountantTanubrataSutantoFahmi&Partner.

2. Approval for utilization of net income for the yearended thirty first December two thousand and ten(31-12-2010)asfollows:(a) as much as Rp 9,391,108,493.00 (nine billion

three hundred ninety one million one hundredeight thousand and four hundred ninety threeRupiah)or15.4%(fifteenpointfourpercent)ofCompanys net profit as cash dividend to theshareholderssothateachofthemwouldearnacashdividendofRp1.00(oneRupiah).

(b) as much as Rp 3,057,415,309.00 (three billionfiftysevenmillionfourhundredfifteenthousandand three hundred nine rupiah) allocated andbooked as reserve fund.

(c) and the rest for Companys working capital;Includinggiving thepowerandauthority to theBoard of Directors to perform any actions needed withrespecttothedecision,inaccordancewiththeregulations.

472011 Annual Report Sierad Produce

3. Memberikan pelunasan dan tanggung jawabsepenuhnya(acquit et decharge)kepadaparaanggotaDireksidananggotaKomisarisataspengurusandanpengawasanyangtelahdijalankanselamatahunbukuyangberakhirpadatanggaltigapuluhsatuDesemberdua ribu sepuluh (31-12-2010), sejauh tindakantersebut tercermin dalam perhitungan tahunanPerseroan;

4. Menetapkan remunerasi bagi Dewan KomisarisPerseroanuntuktahunbuku2011(duaribusebelas),sebanyak-banyaknya Rp 2.000.000.000,00 (duamilyar Rupiah) dan memberikan wewenang kepadaKomisarisUtamauntukmenetapkanalokasinya,danmemberikan wewenang kepada Dewan KomisarisPerseroan untuk menetapkan remunerasi bagi Direksi Perseroan.

5. Menerima pengunduran diri Tuan Rodolfo PaguiaPantoja selaku Direktur Perseroan dan Tuan RoyAtmadja selaku Direktur Perseroan dengan ucapanterima kasih atas jasa-jasanya dan memberikanpelunasan dan pembebasan tanggung jawabsepenuhnya(acquit et decharge)atastindakanyangtelah dilakukan selama melaksanakan jabatannya,sepanjang tindakan tersebut tercermin dalam buku-bukuataucatatan-catatanPerseroan;

6. Memberikan persetujuan untuk memberi kuasadan wewenang kepada Direksi untuk melakukanpenunjukanAkuntanPublikyangterdaftaryangakanmengaudit buku Perseroan untuk tahun buku 2011(dua ribu sebelas), beserta penetapan honorariumdan

DEWAN KOMISARIS

Dewan Komisaris bertanggung jawab terhadappengawasan atas jalannya pengurusan Perseroan olehDireksidanmemberikanpersetujuanatasrencanakerjatahunan Perseroan sesuai dengan Anggaran DasarPerseroan. Dewan Komisaris terdiri dari sekurang-kurangnya 3 (tiga) orang anggota Dewan Komisaris,seorang diantaranya dapat diangkat sebagai KomisarisUtamadanyanglainnyadiangkatsebagaiKomisaris.

PadasaatiniKomisarisSieradProduceterdiridari3(tiga)orang yaitu:

AntoniusJoenoesSupit : KomisarisUtamadanKomisarisIndependen

DjohanEffendy : KomisarisIndependenSriLestariAnwar : Komisaris

Rapat Dewan KomisarisSesuai Anggaran Dasar Perseroan, Rapat DewanKomisaris dapat diadakan sekurangnya setiap bulansekali atau setiapwaktubilamanadianggapperluoleh

3. Approval for acquittal and discharge (acquit et decharge)totheBoardofDirectorsandCommissionersoftheCompanyduringthefinancialyearendedthirtyfirstDecembertwothousandandten(31-12-2010)aslongasreflectedintheAnnualReportandFinancialStatement concerned;

4.TosettheremunerationoftheBoardofCommissionersforthefiscalyear2011(twothousandandeleven)asmuchasRp2,000,000,000.00(twobillionRupiah)andauthorizethePresidentCommissionertodetermineallocations and to give authority to the Board ofCommissioners to determine remuneration for theBoard of Directors

5.AcceptedtheaffirmationresignationofMr.RodolfoPaguiaPantojaandMr.RoyAtmadjaasaDirectorswithgratitudefortheirservicesandgivethegrantoffullacquittalanddischarge(acquitetdecharge)fromtheirmanagerial andsupervisory task to theextentsuch actions reflected in the books and records oftheCompany;

6. To grant powers and authorities to the Board ofDirectors to appoint Public Accountant to audit the Companys Financial Statement for the fiscalyear 2011 (two thousand and eleven), along thedeterminationoffeesandotherrequirementsforit.

BOARD OF COMMISSIONERS

Commissioners are responsible to supervise and guide theBoardofDirectorsinconductingandmanagingtheaffairsoftheCompany, includinggrantingapproval foryearly plans. Board of Commissioners at least consist of 3 members,oneofthemcouldbeappointedasaPresidentCommissionerandtheothersascommissioners.

Currently, Sierad Produces Board of Commissioners has3(three)members:

Antonius Joenoes Supit : President Commissioner and Independent Commissioner

DjohanEffendy : IndependentCommissionerSriLestariAnwar : Commissioner

Board of Commissioners MeetingsAsstipulatedintheCompanysArticlesofAssociation,theBoardofCommissionermustmeetatleastonceamonthorasmanytimesasconsiderednecessarybythe

48 Laporan Tahunan 2011 Sierad Produce

KomisarisUtamaatauoleh1/3(satupertiga)bagiandarijumlahanggotaDewanKomisarisatauataspermintaantertulis dari Rapat Direksi atau atas permintaan dari satu pemegang saham atau lebih yang memiliki sedikitnya1/10(satupersepuluh)bagiandariseluruhjumlahsahamdenganhaksuarayangsah,dalamRapatmanaDewanKomisarisdapatmengundangDireksi.

Selamatahun2011,DewanKomisarismenyelenggarakan2 (dua) kali rapat dengan tingkat kehadiran sebagaiberikut:*)

Nama | Name Tingkat Kehadiran | Attendance Rate

Antonius Joenoes Supit 100%

DjohanEffendy 100%

SriLestariAnwar 100%*) SelaindihadiriolehDewanKomisaris,rapatjugadihadiriolehDireksiPerseroandananggotaKomiteAudit ThemeetingwerealsoattendedbytheCompanysBoardofDirectorsandmembersofAuditCommittee

Untuk membantu pelaksanaan tugas dan tanggungjawabnya,DewanKomisaris telahmembentukKomiteAudit.Komite ini telahmemilikipedomankerja tertulisyang menetapkan tugas dan tanggung jawabnyasebagaimana tertuang dalam Pedoman Kerja KomiteAudit(Audit Committee Charter)dantelahdisetujuiolehDewanKomisaris.

KOMITE AUDIT

Sesuai dengan Peraturan Bapepam-LK No. IX.I.5,Sierad Produce telah membentuk Komite Audituntuk membantu tugas Komisaris. Komite Auditmempunyai tugas utama mendorong diterapkannya tatakelolaperusahaanyangbaik,terbentuknyastrukturpengendalian internal yang memadai, meningkatkan kualitas keterbukaan dan pelaporan keuangan serta mengkaji ruang lingkup, ketepatan, kemandirian danobjektivitasauditoreksternal.

Komite Audit bertanggung-jawab kepada DewanKomisarisdanmembantuDewanKomisarisdenganmelakukantugas-tugasberikut:1. Melakukanevaluasiterhadapefektivitasmekanisme

kontrol internal, dengan melakukan pemeriksaan atas cakupan program audit internal, memeriksa pelaksanaan program audit dan evaluasi atas laporan kegiatan audit internal pada tahun tersebut dengankesimpulanbahwakeseluruhannyatelahmemuaskandan mencerminkan perbaikan atas fungsi kendali internalyangefektifdilingkunganperusahaan.

2. Melakukan penelaahan terhadap laporan keuanganPerseroan, dengan kesimpulan bahwa laporantersebut telahsesuaidenganstandardankebijakanakuntansi yang berlaku, konsisten dengan informasi

PresidentCommissionerorbyatleast1/3(one-third)oftheBoardofCommissioners,oruponwritten requestfromtheMeetingofDirectorsoruponwrittenrequestby one or more shareholders who represent at least1/10 (one-tenth) of the Companys outstanding votingsharesinameetingwheretheBoardofCommissionersmayinvitetheDirectors.

In 2011, the Board of Commissioners held 2 (two)meetings,withattendanceasfollows:*)

The Companys Audit Committee was founded toassist the Board of Commissioners to perform itstasksandresponsibilities.Thecommitteesdutiesandresponsibilities are stipulated in the Audit CommitteeCharter,asetofworkingguidelinesforthecommitteethathasbeenapprovedbytheBoardofCommissioner.

AUDIT COMMITTEE

In accordance to Bapepam-LK Regulation No. IX.I.5,Sierad Produce established an Audit Committee toassisttheBoardofCommissioners.AuditCommitteestasks are encouraging the implementation of GCG,establishment of adequate internal control structure,improving the quality of disclosure and financialinformation as well as evaluating scope, accuracy,independencyandobjectivityofexternalauditor.

The Audit Committee is accountable to the Board ofCommissionersandassiststheBoardofCommissionersincarryingoutthefollowingduties:1. Evaluate the effectiveness of internal control

mechanism through reviewing the scope of theinternalauditprogram,assessingtheimplementationof audit program and evaluation of the reports oninternal audit activities during the year and foundthem satisfactory and should reflect an improvedeffectiveinternalcontrolwithintheCompany.

2. Review financial reports of the Company, with theconclusion that the reports have been preparedaccording to the prevailing accounting standardsand policies, consistent with other information,

492011 Annual Report Sierad Produce

lainnya, dan disampaikan kepada Bursa Efek Indonesia sesuai peraturan yang berlaku.

3. Menelaah ketaatan terhadapperaturanpasarmodaldanBursaEfekIndonesia,dengankesimpulanbahwaPerseroankonsistenmemenuhiketentuan-ketentuantersebut dengan baik.

4. Melakukan diskusi dengan Akuntan Publik untukmengevaluasiindependensidanobjektivitasAkuntanPubliktersebutsertamembahaskecukupanprogrampemeriksaan yang dilakukannya. Dari diskusi ini dapat disimpulkanantaralainbahwaindependensiAkuntanPubliktelahterjagadenganbaik.

5. Melakukan diskusi dengan Akuntan Publik tentangkoreksi-koreksi dan rekomendasi yang diusulkanauditor sebagai hasil pemeriksaan atas laporankeuanganPerseroantahun2011.

KomiteAuditSieradProducepadatahun2011terdiridari3 (anggota), yang salah satunya merupakan KomisarisIndependen, sementara yang lainnya merupakan pihakeksternal sesuai denganperaturanBapepam-LK.SusunanKomiteAuditadalahsebagaiberikut:

AntoniusJoenoesSupit : KetuaEmanAchmadSulaeman : AnggotaRodion Wikanto : Anggota

and delivered to the Indonesia Stock Exchange incompliancewithprevailingregulations.

3. Review the compliance with the capital marketand the Indonesia Stock Exchanges rules andregulations, with the conclusion that the Companyhasconsistentlycompliedtoalltheabovementionedrules and regulations.

4. DiscusswiththePublicAccountant,forthepurposeofreviewingtheindependenceandtheobjectivityofthePublicAccountantandtheadequacyoftheauditprogram. From this discussions it was concluded,amongothers, that the independenceof thePublicAccountanthasbeenproperlymanaged.

5. DiscusswiththePublicAccountantregardingtotheirrecommendationsonauditfindingsandsubsequentmanagement letter,asa resultof theirauditof theCompanys financial statements, for the fiscal year2011.

In 2011, Sierad Produces Audit Committee consist of 3 (Three) members, one of them is IndependentCommissioner,theothersarefromoutsideasregulatedbyBapepam-LK.TheAuditCommitteememberswereasfollows:

AntoniusJoenoesSupit : ChairmanEmanAchmadSulaeman : MemberRodionWikanto : Member

50 Laporan Tahunan 2011 Sierad Produce

Selama tahun 2011 telah dilaksanakan 6 (enam) kaliRapat Komite Audit dengan tingkat kehadiran sebagaiberikut:*)

Nama | Name Tingkat Kehadiran | Attendance Rate

Antonius Joenoes Supit 100%

Rodion Wikanto 100%

EmanAchmadSulaeman 67%*) SelaindihadiriolehKomiteAudit,rapatjugadihadiriolehDireksiPerseroan ThemeetingwerealsoattendedbyAuditCommitteeandtheCompanysBoardofDirectors

DIREKSI

PerseroandiurusdandipimpinolehDireksiyangterdiridarisekurang-kurangnya3(tiga)orangDireksi,seorangdiantaranya dapat diangkat sebagai Direktur Utama,bilamanadiperlukandapatdiangkat seorangatau lebihWakilDirekturUtamadanyanglainnyadiangkatsebagaiDirektur,denganmemperhatikanperaturanyangberlakudi bidang pasar modal.

Direksibertanggungjawabpenuhdalammelaksanakantugasnya untuk kepentingan Perseroan dalam mencapai maksud dan tujuannya. Tugas pokok direksi adalahmemimpin, mengurus dan mengendalikan Perseroan sesuai dengan tujuan Perseroan dan senantiasaberusaha meningkatkan efisiensi dan efektivitasPerseroan; menguasai, memelihara dan menguruskekayaanPerseroan;menyusun rencanakerja tahunanyang memuat anggaran Tahunan Perseroan danwajib disampaikan kepada Dewan Komisaris untukmemperoleh persetujuan dari Dewan Komisaris,sebelumdimulainyatahunbukuyangakandatang.

Saat ini, Direksi PT Sierad Produce Tbk terdiri atas 5 (lima)orangyaitu:BudiardjoTek : DirekturUtamaEkoPutroSandjojo : WakilDirekturUtamaF.XAwiTantra : DirekturSudirman : Direktur SikWeiTjien : Direktur

Rapat DireksiMerujukpadaAnggaraDasarPerseroan,RapatDireksidapat diselenggarakan setiapwaktu apabila dipandangperlu atas permintaan seorang atau lebih anggotaDireksi atau atas permintaan tertulis dari seorang atau lebih anggota Dewan Komisaris, atau atas permintaantertulis 1 (satu) pemegang saham atau lebih yangbersama-samamewakili1/10(satupersepuluh)bagiandarijumlahseluruhsahamdenganhaksuarayangsah,denganmenyebutkanhal-halyangakandibicarakan.

TheAuditCommitteeheld6(six)meetingsin2011,withattendanceasfollows:

DIRECTORS

TheCompanyismanagedandgovernedbyaBoardofDirectorsconsistingofatleastthree(3)Directors,oneofthemcanbeappointedasthePresidentDirector,whenit is necessary can be appointed a Deputy President DirectorandtheotherwasappointedastheDirector,asregulated in capital market.

TheBoardofDirectorsisresponsibleformanagingtheCompany ingoodfaithandwithfull responsibility.Themain tasks of directors is to lead, manage and control the Company in accordance to the objectives of theCompany and continually improve the efficiency andeffectiveness of the Company; to control, to maintainandtomanagethewealthoftheCompany;tocompileannual working plan which includes the CompanysannualbudgetandshallbesubmittedtoandapprovedbytheBoardCommissioners,priortothenextfinancialyear.

The composition the Board of Directors PT SieradProduce,Tbkasisasfollows:BudiardjoTek : PresidentDirectorEkoPutroSandjojo : DeputyPresidentDirectorF.XAwiTantra : DirectorSudirman : Director SikWeiTjien : Director

Board of Directors MeetingsAsstipulatedintheCompanysArticlesofAssociation,MeetingsoftheBoardofDirectorsareheldatanytimeasseemednecessarybyoneormoremembersoftheBoard of Directors or upon written request by one ormoremembersoftheBoardofCommissioner,oruponwrittenrequestby1(one)ormoreshareholder(s)whorepresent(s)atleast1/10(one-tenth)oftheCompanysoutstandingvotingshareswhichmuststatethepointsandissuestobediscussedinthemeeting.

512011 Annual Report Sierad Produce

Sepanjang tahun 2011, Direksi menyelenggarakan 24(dua puluh empat) kali rapat.dengan tingkat kehadiransebagai berikut:

Nama | Name Tingkat Kehadiran | Attendance Rate

BudiardjoTek 100%

EkoPutroSandjojo 100%

Sudirman 100%

F.XAwiTantra 96%*

SikWeiTjien 96%**) KetidakhadiranDireksidalamrapatdisebabkankarenasakitataukeperluanmendesaklainnya AbsencesofDirectorsinthemeetingsareduetoillnessorotherurgentmatters

Selain itu, dalam rangka meningkatkan kompetensi Direksi, Perseroan juga telah mengutus Direksi danjajaran Manajemen lainnya untuk ambil bagian dalamprogram-program pelatihan baik berupa training,workshop, seminar, maupun studi banding, baik diIndonesia maupun di luar negeri.

Pembagian Tugas DireksiDireksi bertugas secara kolegial. Namun agar lebihefisien dan efektif dalam melaksanakan tugas, dilakukan pembagian tugas diantara anggota Direksi sesuai bidang dan kompetensinya. Pembidangan tugas di antara anggota Direksi tidak menghilangkan tanggung jawabDireksiselamakolegialdalampengurusanperusahaan.Setiap anggota Direksi dapat melaksanakan tugas dalam mengambil keputusan namun keputusan Direksi merupakan tanggung jawab bersama. Pembagiantugas Direksi tersebut dilaksanakan untuk memastikan efektifitas pelaksanaan tugas semua anggota Direksi dalam pengelolaan Perseroan.

DalamhalRUPStidakmenetapkanpembidangantugasDireksi, maka pembagian tugas Direksi ditetapkan berdasarkan keputusan Direksi, yaitu sebagai berikut:1. Budiardjo Tek (Direktur Utama) bertanggung jawab

terhadapseluruhkegiatanoperasional.2. Eko Putro Sandjojo (Wakil Direktur Utama)

bertanggung jawabuntukmembantutugasDirekturUtama.

3. Sudirman(Direktur)bertanggungjawabataskegiatanoperasional di Divisi Poultry.

4. F.X Awi Tantra (Direktur) bertanggung jawab ataskegiatan operasional di Divisi Food dan KeuanganKorporasi(Corporate Finance).

5. Sik Wei Tjien (Direktur) bertanggung jawab ataspengendaliankeuangan(Financial Control).

In 2011, the Board of Directors held 24 (twenty four)meetings,withattendanceasfollows:

ForthebenefitsoftheBoardofDirectors,theCompanysent its members and others in the Managementboard to participate in development programs including trainings,workshops,seminarsandcomparativestudiesin Indonesia and abroad.

The Directors Task Division Directors are in collegial charge. In order to be moreefficientandeffectiveinperformingthetasks,thetasksaredividedaamongmembersoftheBoardofDirectorsaccordancetotheirfieldandcompetence.TasksDivisionamong members of the Board of Directors does noteliminatetheirresponsibilityforthecollegialCompanysarrangement. Each member of the Board of Directorscouldcarryoutthetaskofmakingdecisions,butdecisionsofDirectorsisacollectiveresponsibility.Thedivisionoftasks iscarriedout toensure theeffectivenessof theimplementationofthetaskofallmembersoftheBoardofDirectorsoftheCompanysmanagement.

InthecaseoftheGMSdoesnotassignDirectorstasksdivision, thedivisionof tasks issetbydecisionof theBoardofDirectorsBoardofDirectors,asfollows:1. BudiardjoTek (PresidentDirector) is responsible to

alloftheoperationalactivities.2. Eko Putro Sandjojo (Vice President Director) is

responsible to assist Directors duties.3. Sudirman (Director) is responsible to all of the

operational activities in Poultry Division.4. F.XAwiTantra (Director) isresponsibletoallofthe

operational activities in Food Division and Corporate Finance.

5. Sik Wei Tjien (Director) is responsible to Financialcontrol.

52 Laporan Tahunan 2011 Sierad Produce

Kebijakan RemunerasiPemberian remunerasi Dewan Komisaris Perseroanditentukan berdasarkan hasil pencapaian kinerjaPerseroan secara keseluruhan, kinerja masing-masinganggota serta hasil tolok ukur dan survei standarremunerasi Komisaris di Indonesia, yang kemudiandiajukan dan disetujui dalam Rapat Umum PemegangSahamTahunan.

Dalam rapat tersebut juga telah disetujui untukmemberikan wewenang kepada Dewan KomisarisPerseroan untuk menetapkan remunerasi bagi Direksi Perseroan. Sama halnya dengan Dewan Komisaris,penentuanbesarnyaremunerasiDireksijugadidasarkanatas hasil pencapaian kinerja Perseroan secaraKeseluruhan, kinerja masing-masing anggota, sertahasil tolakukurdansurveystandar remunerasisejenisdi Indonesia.

Selama tahun2011, jumlah remunerasiyangdiberikankepada anggota Dewan Komisaris dan Direksi untukhonorarium, gaji dan tunjangan lainnya adalah sebesarRp14.257.777.592,-denganperinciansebagaiberikut:DewanKomisaris : Rp1.318.597.122,-DewanDireksi : Rp12.939.180.470,-

SISTEM PENGENDALIAN INTERNAL

Perseroan dalam melakukan pengendalian internal, selalu berpedoman pada peraturan dan Standard Operating Procedure (SOP)yangtelahditetapkan.Denganmemilikisistem pengendalian internal ini, Perseroan berharapdapat membangun sistem pengendalian internal yang efektifdanefisien.Sisteminijugamenjaminefektifitasproses pengelolaan risiko, pengendalian dan tata kelola, sesuai dengan lingkungan bisnis dan operasi masing-masingunitusaha.

Dalam melakukan pengawasan terhadap prosespengendalianinternal,DireksidibantuolehDepartemenRisk Management and Internal Control. Departemen ini membantu Komisaris, Direksi, dan Komite Audituntuk memasikan bahwa seluruh risiko usaha telahdiidentifikasikan dan dikendalikan melalui sistem pengendalian internal yang efisien dan efektif. Departemenini jugamendukungunit-unitusahadalammenilai,mengendalikandanmemantaurisikousaha.

Renumeration PolicyBoard of Commissioners remuneration is determined based on the overall achievement of the Companysperformance,performanceofeachmemberoftheBoard,aswellastheresultsofbenchmarksandstandardsofremunerationoftheCommissionerinIndonesia,whichisthensubmittedandapprovedintheAGMS.

TheAGMSalsoapprovedtogiveauthoritytotheBoardof Commissioners to determine the remunerationfor the Directors of the Company. As with the Boardof Commissioners, the determination of the amountof remuneration of Directors is also based on theoverallachievementoftheCompanyperformance,theperformance of each member, as well as the resultsof benchmarks and standards of remuneration inIndonesia.

In 2011, salaries and other allowances paid to themembers of Board of Commissioners and Directors amounted to Rp 14,257,777,592,- with the details asfollows:BoardofCommissioners: Rp1,318,597,122,-BoardofDirectors : Rp12,939,180,470,-

INTERNAL CONTROL SYSTEM

Inperformingan internalcontrol, theCompanyalwaysbasedontherulesanddeterminedStandardOperatingProcedure(SOP).Byhavinganinternalcontrolsystem,theCompanyexpectstoestablishaneffectiveandefficientinternal control system. The system also ensures theeffectiveness of risk management processes, control andgoodgovernance,inaccordancewiththebusinessenvironmentandoperationofeachbusinessunit.

In a supervision to the internal control process,Board of Directors assisted by Risk Management andInternal Control Department. This Department helpingCommissioner, Directors and Audit Committee to ensurethatallofthebusinessriskhavebeenidentifiedandcontrolledthroughtheefficientandaffectiveinternalcontrolsystem.ThisDepartmentalsosupportbusinessunits in assessing, controlling and monitoring business risks.

532011 Annual Report Sierad Produce

Risikoyangdimaksuddiantaranyaadalahketersediaandanfluktuasihargabahanbaku,karenasebagianbesarbahanbakuutamayangdigunakanolehPerseroanadalahbarang komoditi seperti jagung dan bungkil kedelai.Ketersediaandanhargabahanbakutersebuttergantungpadakeadaancuaca,panendantingkatpenawarandanpermintaan. Perseroan melakukan impor dari luar negeri untuk memenuhi sebagian kebutuhan bahan bakutertentu, terutama apabila bahan baku tersebut tidaktersediadipasarlokal.Untukmengatasinya,Perseroanterus melakukan penelitian dan pengembangan untuk mencaribahanbakuyangdapatmenjadisubstitusidaribahanbakuyangharusdiimpordariluarnegeritersebutdan melakukan pembelian dalam jumlah besar untukmenekan biaya.

Dengan adanya pembelian bahan baku secara importersebut mengakibatkan Perseroan memiliki eksposur terhadap nilai tukar mata uang Rupiah terhadap matauangnegaralainnyaterutamaDolarAS.Risikoterhadapfluktuasi nilai tukar mata uang ini dapat diantisipasi dengan melakukan natural hedging dan pengelolaan cash management yang baik, serta senantiasa memantau perubahan nilai tukar mata uang asing terhadap nilaiRupiah beserta dengan kondisi-kondisi yang dapatmempengaruhi hal tersebut, agar mendapatkan nilaitukar yang terbaik dalam setiap transaksi.

Selain fluktuasi harga bahan baku, Perseroan jugamenghadapi risiko fluktuasi harga ayam hidup.Sebagaimanadiketahui,ayamhidupmerupakanprodukkomoditi di mana harga ayam hidup dipengaruhioleh tingkat penawaran dan permintaan. Untuk itu,Perseroan berupaya untuk memaksimalkan kapasitas produksi pemotongan ayam modern yang dimiliki untuk mengurangi risiko penurunan harga ayam hidup yangbersifatsementara/musiman.Ayamhidupdipotongdandisimpanuntukkemudiandijualpadasaatharga tinggiataudiproseslebihlanjutmenjadimakananolahan.

Wabah penyakit terhadap peternakan juga merupakanrisiko yang harus dihadapi oleh Perseroan, karenadapat menyebabkan kematian budidaya unggas. Haltersebut juga dapat mengurangi permintaan terhadapprodukPerseroanyangpadaakhirnyaakanmengurangipendapatanPerseroan.Untukmengatasinya,Perseroanselalu menekankan akan pentingnya bio-security baik di seluruh fasilitas yang dimiliki, maupun denganmemberikan konsultasi dan bimbingan kepada para peternak akan pentingnya bio-security tersebut. Selain itu, dilakukan pula vaksinasi terhadap unggas secaraterencanadantermonitordenganbaikuntukmencegahterjangkitnyawabahpenyakit.

Theriskisreferredtoavailabilityandfluctuationinpriceofrawmaterial,becausemostofprimaryrawmaterialsused by Company are commodities such as corn andsoybean meal. The availability and price of thesematerials are depending on the weather, harvest andthelevelofsupplyanddemand.Thecompanyperformsimport from foreign countries to meet the needs ofcertainrawmaterials,especially if thoserawmaterialsisnotavailableinthelocalmarket.Toovercomeit,theCompanycontinuallyperformresearchanddevelopmentto find other raw materials to replace imported rawmaterials and make a bulk purchases to reduce thecost.

Purchasing of imported raw materials causing theCompanyhasanexposurebythechangesintheRupiahagainstforeigncurrencies,especiallytheUSDollar.Thiscurrency risk could be anticipated by natural hedgingandagoodcashmanagement aswell as consistentlymonitoring the changes in exchange rates of foreigncurrencies against the value of the Rupiah and theconditions that can affect it, in order to get the bestexchangerateinanytransaction.

Inadditiontofluctuationsinthepriceofrawmaterials,thecompanyalsohastofacetheriskoffluctuationsinthepriceoflivebirds.Asitisknown,livebirdsarecommodityproduct, its price influenced by level of supply and demand.Therefore,theCompanyattempttomaximizeproduction capacity of its modern slaughterhouses todecreaseriskofatemporarily/seasonalreductionpriceof live birds. Live birds are being cut and stored for later soldathighpricesorprocessedintofoods.

Epidemic against live birds is also a risk faced by theCompany,becauseitcanleadtothedeathofcultivationchicken. It also can reduce demand for the Companyproductsthatwilleventually reducecorporate income.To overcome the problem, the Company alwaysemphasized the importanceofbio-security throughoutall Companys facilities, and by giving consultation and guidancetothefarmerstheimportanceofbio-security.In addition, planned and monitored vaccination against poultryhasalsobeenconductedtopreventthespreadof epidemic.

54 Laporan Tahunan 2011 Sierad Produce

Terkait dengan fasilitas pembiayaan berupa hutangBank dan liabilitas sewa pembiayaan, Perseroanmemiliki eksposur terhadap risiko tingkat suku bunga,risiko kredit dan risiko likuiditas. Untuk meminimalkanrisiko tingkat suku bunga, Perseroan mengelola beban bunga melalui kombinasi hutang dengan suku bungatetap dan suku bunga variable dengan mengevaluasi dengansukubungapasar.Manajemenjugamelakukanpenelaahan berbagai suku bunga yang ditawarkanoleh kreditur untuk mendapatkan suku bunga yangmenguntungkan sebelum mengambil keputusan untuk melakukanperikatanhutang.Perseroanjugasenantiasamelakukan hubungan usaha dengan pihak lain yangmemiliki kredibilitas, menetapkan kebijakan verifikasidan otorisasi kredit, serta memantau kolektibilitas piutang secara berkala untuk mengurangi jumlahpiutang tak tertagih untuk mengendalikan risiko tukar.Sedangkan untuk risiko likuiditas Perseroan melakukan evaluasi berkala atas proyeksi arus kas dan arus kas actual,termasukjadwaljatuhtempohutang,danterusmenerusmelakukanpenelaahanpasarkeuanganuntukmendapatkan sumber pendanaan yang optimal.

SEKRETARIS PERUSAHAAN

Perusahaan mengangkat Sekretaris Perusahaan yangbertugassebagaipejabatpenghubungantaraperusahaandenganorganperusahaandanpemangkukepentingandenganberpedomankepadaPeraturanBapepamdanLKNo.IX.I.4danPeraturanPTBursaEfekIndonesia(BEI)No. I-A butir III.1.8 dan C.15. Sekretaris PerusahaanbertanggungjawabkepadaDireksidanjugamelaporkanpelaksanaantugasnyakepadaDewanKomisaris.

SekretarisPerusahaanmempunyatugaspokoksebagaiberikut:1. Mengikuti perkembangan pasar modal khususnya

peraturan-peraturan yang berlaku di bidang pasarmodal.

2. Memberikan pelayanan kepada masyarakat atassetiap informasi yang dibutuhkan pemodal yangberkaitandengankondisiPerusahaan.

3. Memberikan masukan kepada Direksi Perusahaanuntuk mematuhi ketentuan UU No.8 Tahun 2005tentang pasar modal dan peraturan pelaksanaannya.

Related tofinancing facilities in the formofbank loanandfinanceleaseliabilities,theCompanyhasexposureto interest rate risk, credit risk and liquidity risk. Tominimize interest rate risks, the Company managesinterest expense through a combination of fixed rateloanandvariable interest ratestoevaluate themarketinterest rate. Management also conducted a reviewof various interest rates offered by lenders to obtain favourable interest rates before making a decision to conducttheengagementofdebt.TheCompanyisalsocontinually conduct business relationshipswithotherswhohavecredibility,establishapolicyverificationandcredit authorization, and monitor the collectivity ofreceivablesonaregularbasistoreducetheamountofuncollectible accounts to control exchange rate risks.As for the liquidity risk of the Company periodicallyevaluates the cash flow projections and actual cashflows, including the schedule of debt maturities, andcontinuouslyconductareviewofthefinancialmarketstoobtaintheoptimalsourceoffunding.

CORPORATE SECRETARY

The Company appointed a Corporate Secretary to actasthe liaisonbetweentheCompanyanditscorporateorgans, aswell aswithstakeholders in accordance tothe Bapepam-LK Regulation No. IX.I.4 and IndonesiaStock Exchange (IDX) Regulation No. I-A item III.1.8andC.15.TheCorporateSecretaryisresponsibletotheBoardofDirectorsandreportshisdutiestotheBoardofCommissioners.

The main duties of the Corporate Secretary are asfollows:1. Keeps abreast of the capitalmarket developments,

notablyonexistingcapitalmarketregulations.2. Offers services to the public on all information

requiredby investors in relation to the conditionoftheCompany.

3. ProvidesinputstotheCompanysBoardofDirectorsincomplyingwithprovisionsstipulatedinLawNo.8Year 2005 on the capital market and its functionalregulations.

552011 Annual Report Sierad Produce

4. sebagai penghubung antara perusahaan denganBapepam-LKdanmasyarakat.

5. Menyiapkan Daftar Khusus yang berkaitan dengandireksi, komisaris dan keluarganya baik dalam PerusahaanTercatatmaupunafiliasinyayangantaralainmencakupkepemilikansaham,hubunganbisnisdan peranan lain yang menimbulkan benturan kepentingandenganPerusahaanTercatat

6. Membuat daftar pemegang saham termasukkepemilikan5%(limaperseratus)ataulebih.

7. Menghadiri rapatdireksidanmembuatminutahasilrapat

8. Bertanggung jawab dalam penyelenggaraan RapatUmumPemegangSaham.

Untukitu,PerseroanmenunjukIbuEliesLestariSetiawansebagai Sekretaris Perusahaan PT Sierad ProduceTbk. Selama tahun berjalan, Sekretaris Perusahaanmemastikan kepatuhan Perseroan terhadap seluruhperaturan dan ketentuan bursa di mana efek Perseroan didaftarkansertaperaturan-peraturanlainyangberlaku,dan juga peningkatan ketersediaan informasi kepadamasyarakat umum.

4. Actsas theCompany liaisonwithBapepam-LKandthepublic.

5. Preparesspeciallistsofshareownerships,businessrelationships,andotherrolesthatmaycauseconflictofinterestswiththelistedcompaniesoritsaffiliatedcompanies, in relation tomembersof theBoardofDirectors, the Board of Commissioners and theirfamily.

6. Prepares listofshareholders including the5% (fivepercent)shareownershipsorabove.

7. Presents the Board of Directors meetings andprepares minutes of meetings.

8. Responsible for conducting General Meeting ofShareholders.

For this purpose, the Company appointed Ms. EliesLestari Setiawan as a Corporate Secretary at SieradProduce.TheCorporateSecretaryensurestheCompanycomplytoallrulesandregulationsatthestockexchangewhere the Companys equities are listed and to otherrelevantregulations.ShealsoensuresthepublicalwaysreceiveallthenecessaryinformationabouttheCompanyquicklyandaccurately.

56 Laporan Tahunan 2011 Sierad Produce

Laporan Komite AuditAudit Committee Report

Kepadayangterhormat:DewanKomisarisPT Sierad Produce TbkGedungPlazaCityViewLt.1Jl.KemangTimurNo.22Jakarta 12510

Laporan Komite Audit Untuk Tahun Yang BerakhirTanggal 31 Desember 2011

Laporan inidisusununtukmemenuhiPeraturanBadanPengawas Pasar Modal dan Lembaga Keuangan(Bapepam-LK)NomorIX.I.5,LampiranSuratKeputusanKetua Bapepam Nomor KEP_29/PM/2004, tanggal24 September 2004, mengenai Pembentukan dan PedomanPelaksanaanKerjaKomiteAuditdanPeraturanNoI-A(SLRNo.I-A),LampiranSuratKeputusanDireksiBEJ Nomor 315/BEJ/06/2000, tanggal 30 Juni 2000mengenai Peraturan Umum Pencatatan Saham padaBursa Efek.

KomiteAuditPerusahaanyangsaatinimenjabatterdiridari 3 (tiga) anggota, diketuai oleh Antonius J. Supit,anggotaKomiteAuditadalahEmanAchmadSulaemandanRodionWikantoyangberasaldariluarperusahaan.Tugas pokok dari Komite Audit adalah memberikanpendapat professional yang independen terhadaplaporan keuangan atau hal-hal yang disampaikan olehDireksikepadaKomisaris,sertamengidentifikasihal-halyangmemerlukanperhatianKomisaris.

Sesuai ketentuandalamPiagamKomiteAudit, selamaperiode 2011, Komite Audit PT Sierad Produce Tbk(Perseroan)telahmelakukan6(enam)kalirapat,masing-masingpada:Jumat21Januari,Senin28Maret,Senin30Mei,Jumat15Juli,Selasa25OktoberdanRabu21Desember2011,melingkupihal-halberikut:1. Melakukan evaluasi efektivitas mekanisme

kontrol internal, dengan melakukan pemeriksaan atas cakupan program audit internal, memeriksa pelaksanaan program audit dan evaluasi atas laporan kegiatanaudit internalpada tahun tersebutdengankesimpulanbahwakeseluruhannyatelahmemuaskandan mencerminkan perbaikan atas fungsi kendali internalyangefektifdilingkunganperusahaan.

To CommissionersPT Sierad Produce TbkGedungPlazaCityViewLt.1Jl.KemangTimurNo.22Jakarta 12510

Audits Committee Report for the Year Ended 31December 2011

This report was made to comply with the IndonesianCapital Market Supervisory and Financial Agency(Bapepam-LK).RuleNo.IX.I5,attachmentofChairmanof Bapepams Decree No. KEP-29/PM/2004, dated24 September 2004, regarding The Establishmentand Charter of Committee Audit Work Program andtheSecuritiesListingRegulationNo. I-A (SLRNo. I-A)attachmentofPTBursaEfekJakartaDirectorsDecreeNo.Kep-315/BEJ/06/2000dated30June2000,regardingTheGeneralRequirementforStockListingattheStockExchange.

TheexistingCompanysAuditCommitteecomprises3(three)members,chairedbyMr.AntoniusJ.Supit, anIndependent Commissioner, the other members areMr. Eman Achmad Sulaeman and Mr. Rodion Wikartofrom outside of the Company. The main task of theAudit Committee is giving an independent professional opinion regarding to the reportsandother informationsubmittedbytheBODtotheBOC,aswellastoidentifyissuesthatmayneedattentionoftheBOC.

PursuanttotheAuditCommitteeCharter,duringtheyearof2011,theAuditCommitteeofPTSieradProduce,Tbk(the Company) conducted 6 (six) meetings, i.e: FridayJanuary21,MondayMarch28,MondayMay30,FridayJuly 15, Tuesday October 25 and Wednesday December 212011thatencompassedthefollowing:1. To evaluate the effectiveness of internal control

mechanism through reviewing the scope of theinternalauditprogram,assessingtheimplementationof audit program and evaluation of the reports oninternal audit activities during the year and foundthem satisfactory and should reflect an improvedeffectiveinternalcontrolwithintheCompany.

572011 Annual Report Sierad Produce

2. ToreviewreportsoftheCompany,withtheconclusionthat the reports have been prepared according tothe prevailing accounting standards and policies,consistentwithother information,anddelivered tothe Indonesia Stock Exchange in compliance withprevailing regulations.

3. Review the compliance with the capital marketand the Indonesia Stock Exchanges rules andregulations,with the conclusion that theCompanyhasconsistentlycompliedtoalltheabovementionedrules and regulations.

4. DiscusswiththePublicAccountant,forthepurposeofreviewingtheindependenceandtheobjectivityofthePublicAccountantandtheadequacyoftheauditprogram. From this discussions it was concluded,amongothers,thattheindependenceofthePublicAccountanthasbeenproperlymanaged.

5. DiscusswiththePublicAccountantregardingtotheirrecommendationsonauditfindingsandsubsequentmanagement letter,asaresultoftheirauditoftheCompanysfinancial statements, for thefiscal year2011.

This Report is submitted and signed by the AuditCommittee of PT Sierad Produce, Tbk.

2. Melakukan penelaahan terhadap laporan keuanganPerseroan, dengan kesimpulan bahwa laporantersebuttelahsesuaidenganstandarddankebijakanakuntansi yang berlaku, konsisten dengan informasi lainnya dan disampaikan kepada Bursa Efek Indonesia sesuai peraturan yang berlaku.

3. Menelaahketaatanterhadapperaturanpasarmodaldan Bursa Efek Indonesia, dengan kesimpulan bahwa Perseroan konsisten memenuhi ketentuan-ketentuan tersebut dengan baik.

4. Melakukan diskusi dengan Akuntan Publik untukmengevaluasiindependensidanobjektivitasAkuntanPubliktersebutsertamembahaskecukupanprogrampemeriksaan yang dilakukannya. Dari diskusi ini dapat disimpulkan antara lain bahwa independensiAkuntanPubliktelahterjagadenganbaik.

5. Melakukan diskusi dengan Akuntan Publik tentangkoreksi-koreksi dan rekomendasi yang diusulkanauditor sebagai hasil pemeriksaan atas laporankeuanganPerseroantahun2011.

LaporaninidibuatdanditandatanganiolehKomiteAuditPT Sierad Produce Tbk.

Antonius Joenoes Supit Rodion Wikanto Eman Achmad SulaemanKetua Anggota Anggota

Chairman Member Member

Jakarta, 25 Januari 2012Jakarta, January 25, 2012

58 Laporan Tahunan 2011 Sierad Produce

Tanggung Jawab Sosial PerusahaanCorporate Social Responsibility

Salahsatuindikatoruntukmengukurtingkatkeberhasilansuatu perusahaan adalah dari kemampuannyamensejahterakan masyarakat sekitar dan menjagakelestarian lingkungan hidup. Oleh sebab itu makasebagai salah satu perusahaan publik di Indonesia,Sierad Produce menyadari bahwa perlunya suatuinteraksisosialdenganwargamasyarakatsekitaryangmembutuhkan.

Praktik bisnis yang disertai tanggung jawab terhadapmasyarakat serta lingkungan, terutama yang berlokasi di sekitar Perseroan merupakan latar belakang dari misi sosial yang kami jalankan. Program-program TanggungJawab Sosial Perusahaan (CSR) dirumuskan dengan mengacu kepada UU No. 40/2007 tentang PerseroanTerbatasdandijalankansecaraberkesinambunganolehseluruhlapisankaryawanPerseroan.

Fokus program CSR tahun 2011 pada dasarnyamerupakan kelanjutan program CSR tahun-tahunsebelumnya, yaitu peningkatan gizi dan kesehatanmasyarakat.Fokustersebutdituangkandalamkegiatan-kegiatan sebagai berkut: Pembagian telur rebus kepada siswa Sekolah

Dasar di sekitar lingkungan Perseroan. Tujuan daripembagianrutintersebutadalahuntukmemberikankecukupanakankebutuhanproteindalammenunjangperkembanganfisikdankecerdasananak-anakyangmerupakan calon penerus bangsa.

Oneoftheindicatorsformeasuringthelevelofsuccessof the Company is its ability to provide welfare forsurroundingcommunitiesandpreservetheenvironmentfor a better quality of life. Therefore, as one of theIndonesiaspubliccompany,SieradProducerealizingtheneedofthesocialinteractionwithinneedneighbouringcommunity.

Business practices based on a sense of responsibility to communitiesandtheenvironment,especiallyforpeoplelivingaround theCompany facilities is thebackgroundof our socialmission.CSRprogramswere formulatedwith reference toUUNo.40/2007onLimitedLiabilityCompanies and continuously implemented by all levels ofemployeesoftheCompany.

The focus of 2011 CSR program basically werecontinuing the activities from previous year, namelyimprovingnutritionandhealth.Thisfocusisexpressedinaseriesofactivities,suchas:

Donation of boiled eggs to Elementary Schoolstudents in the surrounding Companys operationarea.Thepurposeofitistomeetthechildrensproteinrequirementinordertosupporttheprospectivenextgenerationsphysicalandintellectualdevelopment.

592011 Annual Report Sierad Produce

Pendistribusian daging ayam kepada panti asuhandan yayasan sosial.

Penyemprotan (fogging) di lokasi-lokasi tempatbersarangnya nyamuk penyebab demam berdarah,malaria, dan sumber penyakit lainnya.

Program donor darah yang diselenggarakan secaraberkala.

Pengobatangratisbagiwargadisekitar lingkunganunitusahaPerseroan.

Selain kegiatan-kegiatan tersebut di atas, Perseroanjugarutinmengadakanprogrambantuanlainnyasepertiperbaikan tempat ibadah, fasilitas umum, bantuankepadapantiasuhan,korbanbencanaalam,penyaluranbuku-bukupelajaran,pemberianbingkisanIdulFitridanlain-lain. Agar program CSR Perseroan dapat berjalansukses,dilakukankerjasamadenganpimpinandaerahdan penduduk setempat.

Adapun biaya yang telah dialokasikan oleh Perseroanuntuk kegiatan CSR tersebut diatas adalah sebesar Rp500juta.

Perseroan mengharapkan dukungan dan kerja samadari seluruh pemangku kepentingan agar dapat lebihbanyak lagi melakukan berbagai kegiatan sosial untuk meningkatkan kesejahteraan masyarakat, terutamakomunitas dan daerah pemukiman di wilayah-wilayahsekitar area operasional Perseroan.

Regulardonationofchickenmeattoanorphanagesandothersocialcharities.

Free fogging in locations where disease-carryingmosquitoesaremostlikelytonest

Regularblooddonordrives Free medical treatment carried out around its

Business unit.

In addition to these activities, the Company also heldothercharityprogramscontinuously,suchasrenovatingreligious houses, public amenities, sending donationto orphanage, victims of natural disasters, distributingschooltextbook,deliveryofgiftsforIdulFitriandothercharityworks.Toensurethesuccessoftheseprograms,alloftheseprogramsweredonewithcooperationwithcommunity leaders and local communities.

The Company has allocated in the sum of Rp 500millionfortheaboveCSRactivities.

The Company expects support and collaborationfrom all of the stakeholders in order to conduct moresocial activities to increase public welfare, especiallycommunitiesandneighbouringareasaroundCompanysfacilities

60 Laporan Tahunan 2011 Sierad Produce

612011 Annual Report Sierad Produce

Management Analysis & Discussion

Analisa & Pembahasan Manajemen

62 Laporan Tahunan 2011 Sierad Produce

Analisa & Pembahasan ManajemenManagementAnalysis&Discussion

632011 Annual Report Sierad Produce

LAPORAN LABA RUGI

Penjualan BersihPenjualanbersihPerseroanpadatahun2011mencapaisebesar Rp 4.029 miliar, mengalami peningkatan sebesar Rp 386 miliar atau naik 10,61% dari penjualan bersihtahun2010yangmencapaisebesarRp3.643miliar.

Peningkatan penjualan bersih terbesar adalah darikenaikan volume penjualan peternakan ayam yangmenghasilkan peningkatan sebesar Rp 194 miliar ataunaik16,73%daritahunsebelumnya.Sertakenaikanpadahargajualpakanternakyangmenghasilkanpeningkatansebesar Rp 137 miliar atau naik 6,41% dibandingkan denganpenjualanbersihtahun2010.

Penjualan bersih tahun 2011 terdiri dari usaha pakanternak sebesar Rp 2.280 miliar atau 56,59% dari total penjualan bersih, dan dari usaha peternakan ayamsebesar Rp 1.352 miliar atau 33,55%, sedangkan dari rumahpotongayamsebesarRp269miliaratau6,68%,sertalain-laintermasukdiluarusahaintisebesarRp128miliar atau 3,18%.

INCOME STATEMENTS

Net SalesCompanys net sales in 2011 attained Rp 4,029 billion, increase by Rp 386 billion or 10.61% from net sales in 2010,whichattainedRp3,643billion.

The biggest increased net sales was the result ofa poultry farming volume, which increase by Rp 194billionor16,73%fromthepreviousyear.Aswellastheincrease inthesalesoffeedmill,whichcontributedanextraRP137billionorincreaseby6.41%comparedtonet sales in 2010.

Net sales in 2011 comprised of feedmill in total Rp 2,280 billion or 56.59% from total net sales, and from poultryfarmingtotallyRp1,352billionor33.55%,whilefromslaughterhouseworth Rp269billionor6.68%,aswellasothernon-coreunitsmadeRp128billionor3.18%.

64 Laporan Tahunan 2011 Sierad Produce

Proporsi penjualan pakan ternak terhadap penjualanbersihtahun2011menurunsebesar2,24%dibandingkandengan tahun sebelumnya. Demikian pula denganpenjualandarirumahpotongayam,dimanakontribusinyamenurun sebesar 1,33%. Sedangkan kontribusi dari usahapeternakanayammengalamipeningkatansebesar1,76%.

Beban Pokok PenjualanBeban pokok penjualan Perseroan pada tahun 2011mengalami kenaikan sebesar Rp 317 miliar atau naik 9,62% dibandingkan dengan tahun sebelumnya yaitusebesarRp3.291miliarditahun2010menjadisebesarRp 3.608 miliar di tahun 2011. Kenaikan pada bebanpokok penjualan timbul dari adanya kenaikan padavolume penjualan tahun 2011. Sedangkan proporsibebanpokokpenjualanterhadappenjualanbersihadalahsebesar 89,55% yang mengalami sedikit penurunan dari tahun2010yaitusebesar90,34%.

Laba KotorPadatahun2011,labakotorPerseroanmencapaisebesarRp 422 miliar dengan proporsi laba kotor terhadappenjualan bersih sebesar 10,46% dan mengalamipeningkatansebesarRp71miliardaritahun2010yangmencapai laba kotor sebesar Rp 351 miliar dengan proporsi laba kotor terhadap penjualan bersih sebesar9,65%.

Theproportionoffeedmillsalescomparedtonetsalesin2011decreasedby2.24%comparedtothepreviousyear. Similarly, the sales of slaughterhouse, where itscontributiondecreasedby1.33%.Whilethecontributionofthepoultrybusinesshasincreasedby1.76%.

Cost of GoodsThe Company posted an increase of Rp 317billion or9.62%in2011,comparedtotheRp3,291billionoftheprevious year become Rp 3,608 billion in 2011. Theincrease of cost of goods come from the increase ofsalesvolume in2011.While theproportionof costofgoodstothenetsalesare89,55%,experiencedaslightdecreasefrom2010thatisequalto90.34%.

Gross ProfitThe Company posted a Rp 422 billion gross profit in2011,withthegrossprofitproportiontonetsalesvalue10.46%andincreasedbyRp71billionfrom2010,withgrossprofitRp351billionandagrossprofit-to-netsalesratio of 9.65%.

652011 Annual Report Sierad Produce

Peningkatanlabakotorterbesardariusahapakanternaksebagaihasildarikenaikanhargajualpakanternakyanglebih tinggi dari kenaikan harga bahan baku sebesar Rp 105 miliar, namun penurunan harga ayammengakibatkan turunnya laba kotor dari peternakan ayam sebesar Rp 64 miliar.

Sedangkanlabakotorrumahpotongayam,usaharetaildan dari luar usaha inti memperoleh peningkatan labakotor sebesar Rp 30 miliar.

Beban UsahaBebanusahatahun2011mengalamikenaikansebesar Rp 81 miliar atau naik 38,29% dibanding tahunsebelumnya,terutamadisebabkanolehkenaikanbebanpenjualan sebesar Rp 33 miliar dan beban umum danadministrasi sebesar Rp 48 miliar.

Kenaikanbebanpenjualandiantaranyaadalahkenaikanpadabebankepegawaian,bebanpengangkutan,bebanpemeliharaan, beban sewa serta beban penyusutanaset tetap. Sedangkan kenaikan beban umum dan administrasi diantaranya adalah kenaikan pada bebankepegawaian,cadanganimbalankerja,bebansewadanasuransisertadendapajak.

Thelargestincreaseingrossprofitarefromthefeedmillbusiness as a result of rising feedmill selling prices which are higher than the increase in raw materialpricesamounting toRp105billion,but thedecreasedin chicken prices lead to lower gross profit from thechickenfarmRp64billion.

Whilegrossprofitofchickenslaughterhouse,andretailbusinessandnon-corebusinessobtaininganincreasein gross profit of Rp 30 billion.

Operating ExpensesOperatingexpensesin2011increasedbyRp81billionorincreasedby38.29%comparedtothepreviousyear,primarily due tohigher sellingexpensesamounting toRp33billionandgeneral andadministrativeexpensesamounting to Rp 48 billion.

The increase insellingexpenses includingan increasein personnel expense, transportation expense, maintenanceexpense,leasedexpenseanddepreciationof fixed assets. While the increase in general andadministrative expenses including an increase inpersonnel expense, reserves for employee benefits,rentandinsuranceexpenseandtaxpenalty.

66 Laporan Tahunan 2011 Sierad Produce

Laba UsahaLaba usaha Perseroan di tahun 2011 mengalamipenurunan sebesar Rp 11 miliar atau turun 7.67% dari sebesarRp140miliarditahun2010menjadi129miliarditahun2011.PenurunanlabausahaterutamadisebabkanolehmeningkatnyabebanusahasebesarRp81miliar,melebihi peningkatan laba kotor yang dapat dicapai ditahun2011yaitusebesarRp71miliar.

Penghasilan dan Beban Lain-LainBebanlain-laintahun2011adalahsebesarRp95miliaryangmengalamikenaikansebesarRp48miliardaritahunsebelumnyayangberjumlahsebesarRp47miliar.

Kenaikantersebutterutamadisebabkanoleh:a. Peningkatan beban keuangan sebesar Rp 39 miliar

sehubungandenganperolehan&penggunaanfasilitaskredit dari beberapa Bank sejalan dengan ekspansiusahayangdilakukanolehPerseroan;

b. NaiknyarugiselisihkurssebesarRp16miliarsebagaiakibat melemahnya Rupiah di tahun 2011. Kurs 1USD tahun 2011 naik dari Rp 8.991 di tahun 2010menjadiRp9.068,sedangkanditahun2010turundari Rp9.400menjadiRp8.991.

Laba BersihLaba bersih tahun 2011 adalah sebesar Rp 22 miliar(2010:Rp61miliar).

Pencapaianlababersihtahun2011mengalamipenurunandibandingkandengantahun2010.Penurunanlababersihtersebutterutamadisebabkanolehmeningkatnyabebanusaha serta beban bunga sebagai akibat dari ekspansiusaha yang dilakukan Perseroan, yang di antaranyaberupa investasi beberapa fasilitas baru yang masihdalam tahap pembangunan dan belum memberikankontribusiterhadappendapatanPerseroan.

TINJAUAN SEGMEN USAHA

Perseroan memiliki beberapa segmen usaha terkaitdengan karakteristik yang berbeda antara satu dengan yang lainnya.Darisisipenjualankonsolidasi,kontribusiterbesar berasal dari segmen pakan ternak, diikuti dengan segmen usaha anak ayam umur sehari, ayampotongdansegmenusahalain-lainyangterdiridariusahamakananolahan,gerai ritelprodukmakanan,peralatanpeternakandanlain-lain.

Pakan TernakPenjualan bersih tahun 2011 meningkat sebesar Rp 137 miliar atau naik 6,41%, terutama disebabkan oleh kenaikanharga jualpakan ternaksebesar7,82%dari tahun 2010. Demikian pula dengan beban pokokpenjualanmengalamikenaikansebesarRp32miliaratau

Operating IncomeCompanys operating profit in 2011 decreased by Rp 11 billion, or fell to 7.67% from Rp 140 billion in 2010 to 129billion in2011.Thedecrease inoperating incomeprimarily due to the increase of operating expensesamounting to Rp 81 billion, exceeding the increase ingrossprofitwhichcanbeachievedin2011amountingto Rp 71 billion.

Other Income and ExpensesOther expenses in 2011 amounted to Rp 95 billion,whichisanincreaseofRp48billionfromthepreviousyearwhichisamountedRp47billion.

Theincreasedprimarilydueto:a. Increase in financial expenses amounting to Rp 39

billiondue to the acquisition and theuseof creditfacilitiesofsomeBanksinlinewiththeCompanysbusinessexpansion;

b. RiseinforeignexchangelossesamountingtoRp16billion as a result of the weakening Rupiahs in theyear2011.Exchangerateof1USDin2011rosefromRp8,991 in2010 toRp9,068,while in2010downfrom Rp 9,400 to Rp 8,991.

Net IncomeNet income in 2011 respectively amounted to Rp 22 billion(2010:Rp61billion).

Thenet profitsdecreased in 2011 compared to2010.The decrease in net income was primarily due to theincreaseofoperatingexpensesandinterestexpenseasaresultoftheCompanysbusinessexpansion,includingtheinvestmentofnewproductionfacilitieswhichisstillonconstructionprogresswhichhasnotcontributedtotheCompanysrevenueyet.

BUSINESS SEGMENT REvIEW

The Company has several business segments relatedtodifferentcharacteristicsof eachbusiness. Intermsof consolidated sales, the largest contribution comesfromthe feedmillsegment, followedbyasegmentofthedayoldchicksbusiness,broilersandotherbusinesssegments consist of processed food business, retail outletsoffoodproducts,poultryequipmentandothers.

FeedmillNet sales in 2011 increased by Rp 137 billion or increase 6.41%,primarilyduetothe increasedfeedmill sellingpricesof7.82%from2010.Similarly,thecostofgoodsincreasedbyRp32billionorincrease1.68%duetothe6.63% increase of raw material prices. Gross profit

672011 Annual Report Sierad Produce

naik1,68%yangdisebabkanolehnaiknyahargabahanbakusebesar6,63%.Labakotordariusahapakanternakmeningkat sebesar Rp 105 miliar atau naik 41,75% yang merupakanhasildaripeningkatanhargajualpakanternakyanglebihtinggidarikenaikanhargabahanbaku.

Anak Ayam Umur SehariPenjualan bersih tahun 2011 meningkat sebesar Rp 194 miliar atau naik 16,73%, terutama dari kenaikan volume penjualan anak ayam umur sehari sebesar3,45%dibandingkandengantahunsebelumnya.Bebanpokok penjualan juga mengalami kenaikan sebesarRp258miliar ataunaik 23,55%yang jugadisebabkanoleh kenaikan volume penjualan. Namun demikian,peningkatan laba bersih yang dicapai dari penjualananakayamumurseharitersebutterkompensasidenganturunnya harga ayam sebesar 5,67% di tahun 2011.Halinimengakibatkanlabakotordariusahapeternakanayam mengalami penurunan sebesar Rp 64 miliar atau turun 104,25%.

Ayam PotongPenjualan bersih tahun 2011 menurun sebesar Rp 22miliar atau turun 7,74%, terutama disebabkan olehturunnya volume penjualan sebesar 8,36% dari tahun2010.Bebanpokokpenjualanjugamengalamipenurunansebesar Rp 29 miliar atau turun 11,09%. Laba kotor dari usahaayampotongmeningkatsebesarRp7miliarataunaik 25,52% yang disebabkan oleh penurunan padabeban pokok penjualan yang lebih besar dibandingkanpenurunanpadapenjualanbersihayampotong.

Lain-lainSegmen usaha makanan olahan merupakan segmenusahabaruditahun2011yangdiakuisisiolehPerseroanpada bulan Oktober 2011. Penjualan bersih lain-laintahun 2011 meningkat sebesar Rp 78 miliar atau naik156,63%daritahun2010,denganpeningkatanterbesardari gerai ritel produk makanan sebesar Rp 44 miliar danmakananolahansebesarRp29miliar.BebanpokokpenjualanmengalamikenaikansebesarRp56miliarataunaik 141,14%, diantaranya karena kenaikan pada beban pokokpenjualandarigerairetailprodukmakanansebesar Rp36miliardandarimakananolahansebesarRp16miliar.LabakotordariusahainimeningkatsebesarRp22miliarataunaik216,08%yangdiperolehdarigerairitelprodukmakanansebesarRp8miliardandariusahamakananolahansebesarRp13miliar.Selain itu,Perseroan jugamemiliki segmen usaha peralatan perunggasan dantepung ikan yang karena nilainya tidak material, maka tidakkamikemukakandidalampembahasanini.

of feedmill business increased by Rp 105 billion or an increaseof41.75% which is as a result ofhigherincrease of feedmill selling price than the increase ofrawmaterialprices.

Day Old ChicksNet sales in 2011 increased by Rp 194 billion, or up to 16.73%, mainly from the increase in sales volumeofdayoldchicksby3.45%compared to thepreviousyear. Cost of sales also increased by Rp 258 billion or an increaseof23.55%,whichisalsoduetohighersalesvolume.However,theincreaseinnetprofitattainedfromthesalesofdayoldchicksarecompensatedbyfallingchickenpricesof5.67%in2011.ThiswasresultedofgrossprofitthechickenfarmbusinessesdecreasedbyRp64billion,down104.25%.

Broiler Chicken Netsales in2011decreasedbyUSD22billion,down7.74%,primarilydue to lower salesvolumeof8.36%from 2010. Cost of sales also declined by Rp 29 billion, down 11.09%. Gross profit from chicken piecesincreased by Rp 7 billion or an increase of 25.52% due tothedecreaseincostofgoodswhichisgreaterthanthedeclineinnetsalesofchickenpieces.

OthersProcessedfoodsbusinesssegmentisanewbusinesssegmentin2011,whichwasacquisitionbytheCompanyin October 2011. Others net sales in 2011 increasedby Rp 78 billion or an increase of 156.63% from 2010, withthelargestincreasearefromretailoutletsoffoodproducts amounted to Rp 44 billion and processed foods of Rp 29 billion. Cost of sales increased by Rp 56 billion oranincreaseof141.14%,includingtheincreaseincostof goods of retail outlets of food products amounted to Rp 36 billion and Rp 16 billion of processed food. Gross profit from this business increased by Rp 22billionoranincreaseof216.08%thatisobtainedfromthe retail outlets of food products of Rp 8 billion andfrom processed food business Rp 13 billion. In addition, the Company also has business segments poultryequipmentandfishmealwhich value isnotmaterial,thenwearenotpointoutinthisdiscussion.

68 Laporan Tahunan 2011 Sierad Produce

RASIO KEUANGAN

Rasio lancar tahun 2011 adalah 1,39 : 1 turundibandingkandengantahun2010sebesar1,89:1.Rasiolancar merupakan tolak ukur kemampuan Perseroan untuk memenuhi kewajiban jangka pendek denganmenggunakan aset lancar yang dimilikinya.

Sedangkan rasio utang terhadap ekuitas tahun 2011adalah 1,08 : 1 naik dibandingkan dengan tahun2010 sebesar 0,65 : 1. Demikian pula dengan rasio utang terhadap aset tahun 2011 adalah 0,52 : 1 naikdibandingkan dengan tahun 2010 sebesar 0,39 : 1.Rasio-rasio inidiperlukanuntukmengukurkemampuanPerseroanuntukmembayarkembalikewajibanpinjamanjangkapendekmaupunjangkapanjang.

NERACA

AsetAset Perseroan tahun 2011 mengalami peningkatansebesar Rp 604 miliar atau naik 29,65% dibandingkan dengantahun2010.Asetlancarmengalamipeningkatansebesar Rp 163 miliar atau naik 15,25% dan aset tidak lancar meningkat sebesar Rp 441 miliar atau naik 45,48% dari tahun2010.Peningkatan terbesarpada aset tidaklancaradalahpadaasettetapsebesarRp419miliarataunaik49,12%daritahun2010melaluipembelianlangsungdanasetdalampenyelesaian.Kenaikaninisejalandenganekspansi usaha yang dilakukan oleh Perseroan yaitupembangunan beberapa fasilitas pembibitan penetasan ayam.

Di samping itu, di tahun 2011 terdapat penambahanbarupadaasettidaklancarberupaaktivatidakberwujudlainnya sebesar Rp 35 miliar dan goodwill sebesar Rp 11 miliar. Penambahan tersebut berkaitan denganpengambilalihan (akuisisi) saham dalam PT BelfoodsIndonesia dengan kepemilikan sebesar 66,99% melalui konversiutangmenjadikepemilikansaham.

LiabilitasLiabilitas Perseroan tahun 2011 meningkat sebesar Rp 566 miliar atau naik 70,37% dibandingkan dengan tahun 2010. Liabilitas jangka pendek meningkatsebesar Rp 319 miliar atau naik 56.48% dari tahun2010. Demikian pula dengan liabilitas jangka panjangmeningkat sebesar Rp 247 miliar atau naik 102,95% dari tahun 2010. Peningkatan terbesar pada liabilitasjangkapendek tahun2011adalahpadapinjamanbankyangmeningkatsebesarRp253miliardanutangusahasebesar Rp 83 miliar. Sedangkan peningkatan terbesar padaliabilitasjangkapanjangadalahpadapinjamanbanksebesarRp226miliardanliabilitasimbalankerjasebesarRp 22 miliar.

FINANCIAL RATIO

Financialratioin2011was1.39:1,downfrom1.89:1in2010.Financialratio isameasureoftheCompanysabilitytomeetshorttermliabilitiesbyusingitscurrentassets.

Debt-to-equityratioin2011wasrecordedat1.08:1upfrom0.65:1in2010.Similarly,debt-to-assetratiowas0.52:1in2011upfrom0.39:1in2010.TheseratiosarerequiredtomeasuretheCompanysabilitytorepaidshort-termandlongtermloanliabilities.

BALANCE SHEET

AssetsCompanys assets in 2011 increased by Rp 604 billion, up 29.65% compared to 2010. Current assets increased by Rp 163 billion or an increase of 15:25% and non-current assets increased by Rp 441 billion, up 45.48% from 2010. The largest increase in noncurrent assetsare in fixed assets amounting to Rp 419 billion, up49.12%from2010throughdirectpurchasesandassetsinprogress.TheincreaseisinlinewiththeCompanysbusiness expansion, including the development ofhatcheryfacilities.

In addition, in 2011 there were new additions to thenon-currentassetsintheformofotherintangibleassetsamounting toRp35billionandgoodwill amounting toRp11billion.TheadditionisrelatedtotheacquisitionofstocksinPTBelfoodsIndonesiawiththeownershipof66.99%throughconversionofdebtintostocks.

LiabilitiesLiabilityof theCompany in2011 increasedbyRp566billion, up 70.37% compared to 2010. Short-termliabilities increased by Rp 319 billion, up 56.48% from 2010. Similarly, the long-term liabilities increased by Rp 247 billion or an increase of 102.95% from 2010. The largest increase in short-term liabilities in 2011wason the increasingofbank loansbyRp253billionandaccountspayableamountingtoRp83billion.Whilethelargestincreaseinlong-termliabilitiesarethebankloan amounting to Rp 226 billion and employee benefits liabilities amounting to Rp 22 billion.

692011 Annual Report Sierad Produce

Peningkatanpinjamanbankditahun2011sehubungandenganekspansiusahayangdilakukanolehPerseroan.

EkuitasEkuitasPerseroantahun2011meningkatsebesarRp38miliarataunaik3,09%dibandingkandengantahun2010.Peningkatanekuitastersebutdarilababersihtahun2011sebesar Rp 22 miliar, dikompensasi dengan pembagian dividenatashasilusahatahun2010sebesarRp9miliardanproporsikepentingannon-pengendalisebesarRp25miliar.

AKSI KORPORASI DAN TRANSAKSI AFILIASI

BerdasarkankeputusanRapatUmumPemegangSahamLuar Biasa Perusahaan pada tanggal 30 Juni 2009,yang telah dituangkan dalam akta berita acara nomor188, telah disetujui pengambilalihan (akuisisi) sahamdalam PT Belfoods Indonesia (BI) sebanyak 596.806saham dengan harga saham Rp 100.000 per sahamdengancarakonversiutangmenjadikepemilikansaham(debt to equity swap). Kepemilikan saham tersebutberasal dari utang PT Belfoods Indonesia sebanyak Rp 59.680.578.837 kepada Perseroan.

Pada tanggal 28 Oktober 2011, Perseroan mengakuisisi 66,99% dari modal saham PT Belfoods Indonesia,sebuah industripengolahanmakananbeku.Akuisisi inidilakukan dengan tujuan untuk memperpanjang rantaiintegrasibisnisdanmewujudkanvisi:To be the leading integrated poultry-based food company in Indonesia.

Disepanjangtahun2011,tidakterdapattransaksiafiliasisebagaimanaperaturanBapepamnomorIX.E.ItentangTransaksi Afiliasi dan Benturan Kepentingan TransaksiTertentu.

KEBIJAKAN DIvIDEN

Dengan memperhatikan hasil usaha Perseroan dalamsatutahun,arahperkembanganPerseroansertareturn menarik yang sewajarnya diterima para pemegangsaham Perseroan, direkomendasikan jumlah dividenyang diusulkan untuk dibagikan, untuk mendapat persetujuanRUPS.

Rekomendasi atas dividen disampaikan oleh DewanKomisaris untuk dibahas dan disetujui dalamRUPS. Rekomendasi yang diajukan akan memberikeseimbangan antara membagikan keuntungan kepada para pemegang saham dengan kebutuhan menahandividenuntukpertumbuhanPerseroan.

Increase in bank loan in 2011 are due to with theCompanysbusinessexpansion.

EquityTheCompanysequityin2011increasedbyRp38billionoranincreaseof3.09%comparedto2010.Theincreaseinequityisfromnetincomein2011amountingtoRp22billion,compensatedbythedividendofbusinessresultin2010amountedtoRp9billionandtheproportionofnon-controllinginterestsamountingtoRp25billion.

AFFILIATED TRANSACTIONS AND CORPORATE ACTION

Based on the Extraordinary General Meeting of theCompanysShareholdersonJune30,2009,whichhasbeen stated in the minutes of the deed number 188,hasapprovedthetakeoverof (acquisition)ofstocks inPTBelfoods Indonesia (BI)of596,806sharesofstockatapriceofRp100,000persharebyaconversionofdebt into shares (debt to equity swap). Ownership ofthese shares from PT Belfoods Indonesias debt of Rp59,680,578,837totheCompany.

OnOctober28,2011,theCompanyacquisited66.99%capital stocks of PT Belfoods Indonesia, a frozen food processingindustry.Theacquisitionwasdoneinordertoextendtheintegrationofbusinesschainandrealizeits vision: To be the leading integrated poultry-basedfoodcompanyinIndonesia.

In the year 2011, there are no affiliate transaction asrulesinBapepamIX.EInumberofAffiliatedTransactionand Conflict of Interest in Certain Transactions.

DIvIDEND POLICY

By considering the business results of the Companywithin one year, the Companys development andattractareasonablereturnreceivedbytheshareholders,the amount of dividend proposed to be shared isrecommendedtoapprovedbytheAGMS.

RecommendationsondividendsmadebytheBoardofCommissioners to be discussed and approved at theAGMS. The recommendations proposed will providea balance between profits distributed to shareholderswiththeneedtorestrainthegrowthoftheCompanysdividend.

70 Laporan Tahunan 2011 Sierad Produce

Berdasarkan hasil keputusan Rapat Umum PemegangSahamTahunanyangdiselenggarakanpadatanggal16Juni 2011, para pemegang saham menyetujui untukmembagikandividentunaiatas lababersihtahun2010sebesar 15,4% atau sebesar Rp 9.391.108.493, dan pada tanggal 10 November 2011 dividen tunai tersebut telahdibayarkan.

Perseroantidakmembagikandividenuntuktahunbuku2008 dan 2009.

INFORMASI DAN FAKTA MATERIAL YANG TERJADI SETELAH TANGGAL LAPORAN AKUNTAN

Tidakterdapatkejadiandanfaktamaterialsetelahtanggallaporan akuntan yang perlu diungkapkan dalam Laporan Tahunanini

ASPEK PEMASARAN

Ditahun2011ini,Perseroanberhasilmempertahankanposisinyadalamjajaran3besarperusahaanpeternakanterpadudiIndonesia.(Sumber:Perseroan) Pakan TernakProduk utama Perseroan adalah pakan ternak, yangmanadiproduksioleh fasilitasproduksi yangberadadiTangerang,SidoarjodanLampung.Adapunbentukpakanternakyangdiproduksiberupakonsentrat(concentrate),tepung (mash), butiran (pellet) atau butiran halus(crumble).

Bahan baku utama yang dipakai dalam pakan ternakadalahjagung,bungkilkedelai,danlain-lain.Disampingmemproduksi pakan ternak untuk ayam pedaging dan petelur, Perseroan juga menawarkan beberapa produkpakan ternak lainnya, seperti pakan untuk babi, telur puyuh, dan lain-lain. Produk pakan ternak ditawarkansesuaikebutuhannutrisipadasetiapmasapertumbuhanternak.

Anak Ayam Umur Sehari (Day Old Chick DOC)Perseroan memproduksi beberapa jenis DOC yangterdiri dari: 1. DOC Ayam Pedaging DOC ayam pedaging adalah anak ayam usia

sehari yang dibudidayakan oleh peternak untukmenghasilkan daging ayam. Ayam pedaging, atauyang sering disebut dengan ayam potong, dibudidaya selamakuranglebih35harisebelumdipanendenganberatrata-ratamencapai1,32kgayam.

BasedonthedecisionoftheAnnualGeneralMeetingofShareholdersheldonJune16,2011, theshareholdersagreedtodistributecashdividendsinnetincomein2010of 15.4% or Rp 9,391,108,493, and on 10 November 2011thecashdividendhasbeenpaid.

TheCompanydoesnotdistributedividendsfortheyear2008 and 2009.

INFORMATION AND MATERIAL FACT THAT SUBSEQUENT REPORT ACCOUNTANT

There are no material facts and events after the dateof the accountants report should be disclosed in thisAnnual Report.

ASPECTS OF MARKETING

Intheyear2011,theCompanymanagedtomaintainitspositionintheranksofthe3largeintegratedlivestockcompaniesinIndonesia.(Source:Company)

FeedmillCompanysmainproductisfeedmill,whichisproducedbyaproductionfacilitylocatedinTangerang,SidoarjoandLampung.Feedmillproducedintheformofconcentrate,mash,pelletsorcrumble.

Themainrawmaterialsusedinfeedmilliscorn,soybeanmeal,andothers. Inaddition toproducing feedmill forbroiler chickens and laying hens, the Company alsooffersseveralotherfeedmillproducts,suchasfeedforpigs, quail, and others. Feedmill products are offeredaccording to the nutritional needs of cattle at eachgrowthperiod.

Day Old Chick DOCTheCompanyproduceseveralformsofDOC,including:

1. Broiler DOC BroilerDOCaredayoldchickscultivatedbybreeders

toproducechickenmeat.Broiler,oroftencalledthechicken pieces, cultured for approximately 35 daysbeforeweighingharvestedanaverageof1.3 -2kgchicken.

712011 Annual Report Sierad Produce

2. DOC Ayam Petelur (Betina) DOC ayam petelur (betina) adalah anak ayam usia

sehari yang dibudidaya oleh peternak untukmenghasilkan telur ayam. Ayam petelur mulaimenghasilkantelurayampadaumursekitar18mingguhingga afkir pada umur sekitar 80 minggu. Secararata-rata,setiapayampetelurdapatmenghasilkan1telurayamsetiap24-28jampadaperiodepeneluran.

3. DOC Ayam Petelur (Jantan) DOC ayam petelur jantan adalah anak ayam usia

sehari yang dibudidayakan oleh peternak untukmenghasilkan daging ayam. Sering juga disebutdenganayampejantan.

Peternakanayam indukPerseroanberadadidaerahJawa Barat dan Jawa Timur. Perseroan berencanauntuk mengembangkan peternakan ayam induk di luarpulauJawapadatahunmendatang.

Ayam PotongPerseroan memiliki dua fasilitas pemotongan ayam, yakni didaerahParungJawaBarat,danMojokertoJawaTimur.FasilitaspemotonganayamdidaerahParung-JawaBarat merupakan fasilitas pemotongan ayam terbesar di Indonesia dengan kapasitas sebesar 100.000 ekor ayamperharinya.Produkyangdihasilkanberupaayampotong berupa karkas, parting dan boneless. Produk ayam potong ini dipasarkan di beberapa International fast food restaurant di Indonesia, cafe dan restoran lainnya,supermarket,hypermarket,sertagerairitelyangdimiliki oleh Perseroan: Bel-Mart. Bel-Mart merupakanconvinience store yang selain memasarkan produk ayam segar, juga ayam olahan siap saji dan bumbu-bumbu/pelengkap dapur lainnya.

Makanan OlahanMakanan olahan yang diproduksi Perseroan berupadaging ayam olahan siap saji seperti chicken nugget,sosis, kornet yang dihasilkan dari fasilitas produksiyang berada di Jonggol Jawa Barat. Perseroanmenggunakan merek dagang Belfoods dalammemasarkan produknya. Produk Belfoods banyak dijumpaibaikdipasarmodernmaupunpasartradisional.Selain itu, Perseroan juga memasok makanan olahanjadi ke beberapa International fast food restaurant di Indonesia, cafe dan restoran lainnya.

2. DOC Layer (Female) DOClayer(female) isadayoldchickscultivatedby

breeders to produce eggs. Laying hens began toproduceeggsattheageofabout18weekstosalvagetheageofabout80weeks.Onaverage,eachlayinghenscanproduceoneeggevery24-28hoursinthespawningperiod.

3. DOC Layer (Male) DOClayer(male)isadayoldchicksarecultivatedby

breederstoproducechickenmeat.Oftencalledthemalechicken.

TheCompanyschickenfarmlocatedinWestJavaandEastJava.TheCompanyplanstodevelopachickenfarmoutsidetheJavaislandinthenextcomingyear.

Broiler ChickenTheCompanyhastwochickenslaughterhousesfacility,at Parung - West Java, and Mojokerto - East Java.ChickenslaughterhousefacilitiesinParung-WestJavais Indonesias largest chicken slaughterhouse with acapacity of 100,000 birds per day. Products produced intheformofachickencarcass,partingsandboneless.Chickenproductsaremarketedinseveral Internationalfast food restaurant in Indonesia, cafe and restaurant, supermarket,hypermarket,andretailoutletsownedbytheCompany:BelMart.BelMartisaconveniencestorethatinadditiontosellfreshchickenproducts,alsosellfast food and processed chicken spices/other kitchencomplement.

Processed foodThe Companys processed foods are produced in theform of processed chicken fast food such as chickennuggets, sausages, corned beef as a result from theproductionfacility located inJonggol -WestJava.TheCompany uses the trademark Belfoods in sellingtheir products. Belfoods products commonly found inboth the modern and traditional markets. In addition,the Company also supplies processed food to severalInternational fast food restaurant in Indonesia, cafe and otherrestaurants.

72 Laporan Tahunan 2011 Sierad Produce

PROSPEK DAN STRATEGI USAHA

Prospek atas industri peternakan di Indonesia masihsangatlahbesar.Halinidisebabkanolehbeberapafaktoryaitu:

Tingkat konsumsi daging ayam yang relatif masihrendahdiIndonesiasertatingginyajumlahpendudukIndonesia dibandingkan dengan negara Asia Tenggara lainnya sehingga menjadikan industri ini masihmenjanjikanpadabeberapatahunkedepan.

Daging dan telur ayam merupakan sumber proteinhewani termurah jika dibandingkan dengan sumberproteinhewanilainnyasehinggamerupakanalternatifterbaikbagipendudukIndonesiadidalammemenuhisumberproteinhewanimereka.

Seiring dengan peningkatan pendapatan per kapitaIndonesia,diharapkantingkatkonsumsidagingayamjuga mengalami kenaikan pada beberapa tahun kedepan. Hal ini disebabkan oleh semakin tingginyatingkat kesadaran masyarakat Indonesia akan pentingnya sumber protein hewani, terutama bagipertumbuhanfisikdankecerdasananak.

Indonesia merupakan salah satu negara denganpopulasi penduduk muslim terbesar di dunia, dan daging ayam merupakan salah satu makanan yangdihalalkan untuk dikonsumsi menurut kepercayaanagama tersebut.

PROSPECTS AND BUSINESS STRATEGY

Prospects for the livestock industry in Indonesia stillverylarge.Thisiscausedbyseveralfactors:

ThechickenmeatconsumptioninIndonesia relatively low and the high population of Indonesia

comparedtootherSoutheastAsiancountriesmadethis industry remains promising in the next fewyears.

Chickenmeatandeggsarethecheapestsourceofanimalproteinwhenitiscomparedtoothersourcesofanimalprotein,sothatisthebestalternativeforIndonesian people to meet their source of animalprotein.

In line with the increase of income per capita ofIndonesia, we expected the increased of chickenmeatconsumptionlevel inthenextfewyears.Thisiscausedby increasingpublicawarenessabouttheimportance of source of animal protein, especially for physicalgrowthandintelligenceofchildren.

Indonesia is one of the largest Muslim populationcountryintheworld,andchickenmeatisoneofthehalalfoodwhichcanbeconsumedaccordingtothereligious beliefs.

732011 Annual Report Sierad Produce

Ditahun2012mendatang,Perseroanakanmelanjutkanstrategiyangtelahdilakukanditahun-tahunsebelumnyaantara lain: Mengoptimalkan kapasitas produksi pakan ternak

yang sudah ada dan melakukan efisiensi prosesproduksi.

Mendirikan beberapa fasilitas baru dan perluasanpasarterutamadiluarpulauJawa.

Bergerakkearahhilir,yaknidenganmengembangkanBelMartdanindustripengolahanmakanan.

In2012,theCompanywillcontinuethestrategythathasbeen done in previous years including:

Optimizing the feedmill production capacity andimprovetheefficiencyintheproductionprocess.

Establishedanewfacilityandexpansionofmarkets,especially outside Java.

Moving the downstream direction, namely bydevelopingBelMartandfoodprocessingindustries.

74 Laporan Tahunan 2011 Sierad Produce

752011 Annual Report Sierad Produce

Corporate Data

Data Perusahaan

76 Laporan Tahunan 2011 Sierad Produce

Profil Dewan KomisarisBoard of Commissioners Profile

Antonius Joenoes SupitKomisaris Utama dan Komisaris IndependenPresident Commissioner and Independent Commissioner

WargaNegaraIndonesiayanglahirpadatahun1950.BeliaumulaibergabungdenganPerseroansejaktahun2000.SebelumdiangkatsebagaiKomisarisUtamadanKomisarisIndependenpadatahun2006,beliaupernahmenjabatsebagaiDirekturdiPTLintasAdhikrida.SaatinibeliaujugamenjabatsebagaiKetuaKomiteAuditPerseroan.BeliaujugaaktifdalamberbagaiorganisasidiantaranyasebagaiketuadariAsosiasiPengusahaIndonesia(APINDO)sejakMaret2003,KetuaGabunganPerusahaanPerunggasanIndonesia(GAPPI)sejaktahun2002,danAnggotaKomitePemulihanEkonomiNasional(KPEN)sejaktahun2000.Selainitu,beliaujugapernahmenjabatsebagaianggotaDewanPengembanganUsahaNasional(DPUN)danKetuaAsosiasiPersepatuanIndonesia(APRISINDO).

Indonesiancitizenwhichwasbornin1950.HestarttojoinedtheCompanyin2000.BeforebeingappointedasaPresident Commissioner and Independent Commissioner in2006,hewasaDirectoratPTLintasAdhikrida.HealsoservesasaChairmanoftheAuditCommitteefortheCompany.HeisnowactivelyinvolvedasaChairmanoftheIndonesianEmployersAssociation(APINDO)sinceMarch2003,ChairmanoftheIndonesianAssociationofPoultryCompany(GAPPI)since2002andamemberofNationalEconomicRecoveryCommittee(KPEN).InadditionhehasalsobeenamemberoftheNationalBusinessDevelopmentCouncil(DPUN)andChairmanoftheIndonesianFootwearAsssociation(APRISINDO)

772011 Annual Report Sierad Produce

Djohan EffendyKomisaris IndependenIndependent Commissioner

WargaNegaraIndonesiayanglahirpadatahun1939.BeliaumenjabatsebagaiKomisarisIndependenPerseroansejaktahun2001.Memilikipengalamandibirokrasiselama42tahunsejaktahun1960hingga2002dansaatinimasihaktifdalamberbagaikegiatanlintasagamadankepercayaan.BeliaumeraihgelarDoctordariUniversitasDeakin,Geelong,Australiapadatahun2000.

Indonesiancitizenwhichwasbornin1939.HeservesasCommissionerIndependentsince2001.Hehasanimpressive42yearsofexperienceingovernmentbureaucracyfrom1960 to 2002 and currently active in many activitiestopromoteinter-religiondialogue.HeobtainhisDoctorateDegreefromDeakinUniversity,Geelong,Australiain2000.

Sri Lestari AnwarKomisarisCommissioner

WargaNegaraIndonesiayanglahirpadatahun1961.BergabungdenganPerseroansejaktahun1994dandiangkatsebagaiKomisarissejaktahun1996.BeliaumerupakanSarjanaPeternakandariUniversitasPadjadjaranBandung.

Indonesiancitizenwhichwasbornin1961.ShejoinedtheCompanysince1994andhasbeenelectedasCommissionersince1996.SheisaBachelorDegreeinanimalhusbandryfromUniversitasPadjadjaran,Bandung.

78 Laporan Tahunan 2011 Sierad Produce

Profil DireksiBoard of Directors Profile

Budiardjo TekDirektur Utama

President Director

WargaNegaraIndonesiayanglahirpadatahun1957.BeliaukembalimenjabatsebagaiDirekturUtama

padatahun2006,jabatanyangsebelumnyapernahdipegangsejaktahun1987.Beliautelahbergabung

denganPerseroansejaktahun1984.MeraihgelarBachelorofBusinessAdministrationdariCaliforniaStateUniversitydiFresno,USApadatahun1983.

Indonesiancitizenwhichwasbornin1957.Hehasbeenre-servingasPresidentDirectorin2006,the

positiontowhichhewastrustedtosince1987.HejoinedtheCompanysgroupin1984aftergaininghisBachelorofBusinessAdministrationfromCalifornia

StateUniversityinFresno,USAin1983.

792011 Annual Report Sierad Produce

80 Laporan Tahunan 2011 Sierad Produce

Eko Putro SandjojoWakil Direktur UtamaVice President Director

WargaNegaraIndonesiayanglahirpadatahun1965.BeliaudiangkatsebagaiwakilDirekturUtamasejaktahun2009.SebelumnyabeliaupernahmenjabatsebagaiDirekturUtamaPerseroanpadatahun2005-2006danDirekturpadatahun1997-2005.MemilikipengalamandiberbagaiperusahaandiantaranyasebagaiDirekturUtamapadaPTHumpus(2006-2009),dansebagaiGeneralManagerdiPTIndonesiaFarming(1994-1997).MeraihgelarMasterofBusinessAdministrationdariInstitutePengembanganManajemenIndonesia(IPMI),Jakartapadatahun1993,BachelorinElectricalEngineeringdariUniversityofKentucky(UK),Lexington,AmerikaSerikatpadatahun1991danDiplomaIIIPoliteknikdiBidangTeknikElektrodariUniversitasIndonesia,Jakartapadatahun1986.

Indonesiancitizenwhichwasbornin1965.Hehasbeenappointed as Deputy President Director since 2009 and prior, hewasPresidentDirectorin2005-2006andDirectorin1997-2005.HehasconsiderableexperienceinseveralcompaniessuchasPTHumpussasaPresidentDirector(2006-2009),PTAmericanPresidentLineIndonesiaasDirector(2003-2005)andPTIndonesiaFarmingasGeneralManager(1994-1997).HeobtainedhisMasterofBusinessAdministrationfromInstitutPengembanganManajemenIndonesia(IPMI),Jakartain1993,BachelorDegreeinElectricalEngineeringfromUniversityofKentucky(UK),Lexington,USAin1991,and Diploma III Politeknik in Electrical Engineering from UniversitasIndonesia,Jakartain1986.

Franciscus Xavarius Awi TantraDirektur

Director

WargaNegaraIndonesiayanglahirpadatahun1954.BeliaukembalimenjabatsebagaiDirektursejaktahun2010.BergabungdengangrupPerseroansejaktahun1994denganposisiterakhirsebagaiKomisaris.SebelumnyabeliaupernahmenjabatsebagaiDirektur/DirekturUtamadibeberapaperusahaandiantaranyaPTMiratamaMadssedjati(1993-1994),PTGelombangTranskencana(1991-1994)danPTBetamasMuliaLeasing(1987-1994).MeraihgelarMasterofBusinessAdministrationdariBarryCollege,GeorgiaUSApadatahun1980. Indonesiancitizenwhichwasbornin1954.Hehasbeenre-appointedasDirectorin2010.HehasjoinedtheCompanysince1994withthelatestpositionasCommissioner.PriortojointheCompany,hewasDirector/PresidentDirectorofseveralcompanies,amongothers,PTMiratamaMadssedjati(1993-1994),PTGelombangTranskencana(1991-1994)and PTBetamasMuliaLeasing(1987-1994).HeobtainedhisMasterofBusinessAdministrationfromBarryCollege,Georgia,USAin1980.

812011 Annual Report Sierad Produce

Sik Wei TjienDirektur

Director

WargaNegaraIndonesiayanglahirpadatahun1964.BeliaukembalimenjabatsebagaiDirekturPerseroansejaktahun2010,dantelahbergabungdengangrupPerseroansejaktahun1990.MemilikipengalamandibidangfinancedanaccountingdibeberapaperusahaandiantaranyapadaPTMacroHumasindo(1988-1989),PTKaruniaHarapanRaya(1985-1988),danPTMetroBusindoMahkota(1983-1985).MeraihgelarSarjanaAkuntansidariSekolahTinggiIlmuEkonomiIndonesiapadatahun1986.

Indonesiancitizenwhichwasbornin1964.Shehasbeenre-appointedasDirectoron2010andhasworkedfortheCompanysgroupsince1990.Shehasexperienceinfinanceandaccountingofseveralcompanies,suchasPTMarcoHumasindo(1988-1989),PTKaruniaHarapanJaya(1985-1988),andPTMetroBusindoMahkota(1983-1985).SheobtainedherBachelorDegreeinAccountingfromSekolahTinggiIlmu Ekonomi Indonesia in 1986

SudirmanDirektur

Director

WargaNegaraIndonesiayanglahirpadatahun1970.BeliaumenjabatsebagaiDirektursejaktahun2009,sebelumnyabeliaupernahbergabungdenganPerseroandalamkurunwaktu1997-2004.MempunyaibanyakpengalamansebagaiDirekturUtama/ManajemenSeniordiantaranyapada PTBiotekIndonesia(2004-2009)danPTCharoenPokphandIndonesia(1994-1997).BeliaumeraihgelarDokterHewandariUniversitasAirlanggaSurabayatahun1994.Saatiniaktifpadaberbagaiorganisasi,diantaranyasebagaiKetuaGabunganPengusahaMakananTernak(GPMT)sejaktahun2009, Anggota World Veterinary Poultry Associationsejaktahun2006,AnggotaWorld Poultry Science Association sejak2004,sebagaiKetuaKomiteAd-hoc Pengendalian Avian Influenza sejaktahun2003.

Indonesiancitizenwhichwasbornin1970.HehasbeenassignasDirectorsince2009,priorheworkedfortheCompanysgroupduring1997-2004.HehasconsiderableexperienceasPresidentDirector/SeniorManagersuchasPTBiotekIndoneasi(2004-2009)andPTCharoenPokphandIndonesia(1994-1997).HeobtainedhisDoctorDegreeinVeterinarianfromUniversitasAirlangga,Surabayain1994.HeisnowactivelyinvolvedinvariousorganizationsuchasIndonesiaFeedProducerAssociation(GPMT)asChairmansince2009,memberoftheWorldVeterinaryPoultryAssociationsince2006,memberoftheWorldPoultryScienceAssociationsince2004andChairmanoftheCommitteeAd-hocControlofAvianInfluenzasince2003.

82 Laporan Tahunan 2011 Sierad Produce

Profil Komite AuditAudit Committees Profile

DiangkatsebagaiKetuaKomiteAuditPerseroansejaktahun2004.SaatinibeliaujugamenjabatsebagaiKomisarisUtamadanKomisarisIndependenPerseroan.

HasbeenappointedasachairmanofCompanysAuditCommitteesince2004.Today,heisalsothePresidentCommissionerandIndependentCommissioneroftheCompany.

Antonius Joenoes SupitKetuaChairman

832011 Annual Report Sierad Produce

Eman Achmad SulaemanAnggotaMember

DiangkatsebagaianggotaKomiteAuditPerseroansejaktahun2004.BeliauadalahManaging PartnerpadaEmanAchmad&Co,Advocates & Counsellor-at-Law,dantelahberpraktiksebagaikonsultanhukumsejak1993danterdaftarsebagaiAdvokatsejaktahun1996.

HasbeenappointedasamemberofAuditCommitteeoftheCompanysince2004.HeisaManagingPartneratEmanAchmad&Co,Advocates&Counsellors-at-Law,andhasbeenalawconsultantsince1993andisregisteredasadvocate since 1996.

Rodion WikantoAnggotaMember

DiangkatsebagaiKomiteAuditPerseroansejaktahun2009.SaatinibeliaujugamenjabatsebagaiKomisarisdanKomiteAuditdibeberapaperusahaanpubliklain.

HasbeenappointedasamemberofAuditCommitteeoftheCompanysince2009.CurrentlyheisalsoappointedasCommissionerandAuditCommitteeinotherpubliccompany.

84 Laporan Tahunan 2011 Sierad Produce

SekretarisPerusahaanCorporate Secretary

Elies Lestari SetiawanSekretaris PerusahaanCorporate Secretary

WargaNegaraIndonesia,lahirpadatahun1977.BeliaudiangkatsebagaiSekretarisPerusahaanpadatahun2006dantelahbergabungdengangrupPerseroansejaktahun2003.SebelumnyapernahmenjabatsebagaiAssociate Debt Securities di PT DBS Vickers Securities (2002-2003)danFinance ManagerdiPTGrandKartech(2000-2002).MeraihgelarMagisterManajemendariUniversitasBinaNusantarapadatahun2007danSarjanaEkonomidariUniversitasKristenSatyaWacanapadatahun1999.

Indonesiancitizen,bornin1977.ShehasbeenappointedasCorporateSecretarysince2006.ShejoinedCompanysgroupin2003.Previously,sheworkedasAssociate Debt Security at PT DBS Vickers Securities (2002-2003)andasFinanceManageratPTGrandKartech(2000-2002).SheobtainedherMasterDegreeinManagementfromUniversitasBinaNusantarain2007andherBachelorDegreeinEconomicsfromUniversitasKristenSatyaWacanain1999.

852011 Annual Report Sierad Produce

Alamat PerusahaanCompany Address

PT SIERAD PRODUCE TBKJl.RayaParungKm.19DesaJabonMekarParung,Bogor,JawaBaratTel. 0251-611862,617307,617268Fax.0251-611079,617620

Kantor Pusat | Head OfficeGedungPlazaCityViewLt.1Jl.KemangTimurNo.22Jakarta 12510Tel. 021-7193888Fax.021-7193889

Divisi Pembibitan Ayam | Breeding DivisionJl.RayaParungKM.19Desa Pamegar SariParung,Bogor,JawaBaratTel. 0251-611143Fax.0251-611655

Divisi Pakan Ternak | Feedmill Division Jl.RayaSerangKm.31,Balaraja Tangerang, Banten Tel. 021-5953888 Fax.021-5950150

Jl.RayaSidoarjo-Krian,DesaKetimang Wonoayu,Sidoarjo,JawaTimur Tel. 031-8852804-06,8853333 Fax.031-8852810

Jl.Ir.SutamiKm.12,DesaSukaNegara TanjungBintang,LampungSelatan Tel. 0721-351175 Fax.0721-351173

PT SIERAD Industries - Industri Peralatan TernakPoultry Equipment IndustryJl.ModernIndustriNo.24KawasanIndustriModernCikande-Serang,BantenTel. 0254-402536-37Fax.0254-402538

Divisi Kemitraan/Peternakan KomersialPatnership/Farming Division Jl.RayaParungKm.19 Desa Pamegar Sari, Tel. 0251-611143 Fax.0251-611655

Komp.RukoPrayudanpermaiBlokB.19-20 Jl.Mertoyudan,Magelang Tel. 0293-325191 Fax.0293-325191

Jl.RayaSidoarjo-Krian,DesaKetimang Wonoayu,Sidoarjo,JawaTimur Tel. 031-8852804-06,8853333 Fax.031-8852810

Divisi Rumah Potong AyamSlaughterhouse Division Jl.RayaParungKm.19 DesaJabonMekar Parung,Bogor,JawaBarat. Tel. 0251-611862,617307,617268 Fax. 0251-611079,617620

Jl.RayaKH.HasyimKM.12 DesaSawo,KecamatanJatis Mojokerto,JawaTimur61353 Tel.0321-3716422 Fax.0321-3716420

Divisi Ritel (BelMart)Retail Division (BelMart)Jl.KemangTimurRayaNo.15Jakarta 12510Tel. 021-7182202Fax.021-7182371-72

Divisi Makanan OlahanFood ProcessingPerumCitraIndahKav.PA1&2Jl.RayaJonggolKM.23,3Jonggol-Bogor16830Tel. 021-89931234Fax.021-89931867-68

PT Dwipa Mina Nusantara - Industri Tepung IkanFish Meal IndustryDusunKetapangDesaPengambenganNegaraJembrana-BaliTel. 0365-42147Fax.0365-42148

86 Laporan Tahunan 2011 Sierad Produce

LEMBAGA DAN ATAU PROFESI PENUNJANG PASAR MODALINSTITUTIONS AND/OR CAPITAL MARKET SUPPORTING PROFESSIONAL

Auditor IndependenIndependent AuditorTanubrataSutantoFahmi&RekanPrudentialTower,17thflJl.Jend.SudirmanKav.79Jakarta 12910Tel. 021-57957300Fax.021-57957301

Konsultan HukumLegal ConsultantKantorHukumSoesiloAribowo&RekanKompleksFatmawariMasI/111,Jl.RSFatmawatiRayaNo.20Jakarta SelatanTel. 021-7654878,7654879Fax.021-7654879

Biro Administrasi EfekShare RegistrarPT.RayaSahamRegistraGd.PlazaSentralLt.2Jl.Jend.SudirmanKav.47-48Jakarta 12930Tel. 021-2525666Fax.021-2525028

872011 Annual Report Sierad Produce

President Director

Deputy President Director

Trading & Logistic Central Purchasing

Business Development

Poultry Division Food Division Finance

Struktur OrganisasiOrganization Structure

Internal Audit

Corp. Finance & Investor Relation

Corporate Secretary Human Capital

88 Laporan Tahunan 2011 Sierad Produce

SeluruhAnggotaDewanKomisarisdanDireksiPTSieradProduceTbkyangberkedudukandiBogor(Perseroan)denganinimenyatakanbertanggungjawabpenuhataskebenaranisiLaporanTahunanPerseroantahun2011.

The member of the Board of Commisioners and theBoard of Dirctors of PT Sierad Produce Tbk located at Bogor (The Company) hereby declare that they willbefullyresponsibleforthecorrectnessofthecontentofAnnualReportoftheCompanyfortheyear2011.

PernyataanDeclaration

Djohan EffendyKomisaris Independen

Independent Commissioner

Sri Lestari AnwarKomisaris

Commissioner

Antonius Joenoes SupitKomisaris Utama dan Komisaris Independen

President Commissioner and Independent Commissioner

Eko Putro SandjojoWakil Direktur Utama

Deputy President Director

Budiardjo TekDirektur Utama

President Director

Franciscus Xavarius Awi TantraDirekturDirector

Sik Wei TjienDirekturDirector

SudirmanDirekturDirector

Dewan KomisarisBoard of Commissioners

DireksiBoard of Directors

892011 Annual Report Sierad Produce

Financial Report

LaporanKeuangan

PT Sierad Produce TbkDan Entitas Anak

LaporanKeuanganKonsolidasian31 Desember 2011 Dan 2010DanLaporan Auditor Independen

PT Sierad Produce TbkAnd Subsidiaries

Consolidated Financial Statements31 December 2011and 2010AndIndependent Auditors Report

90 Laporan Tahunan 2011 Sierad Produce

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES LAPORAN KEUANGAN KONSOLIDASIAN CONSOLIDATED FINANCIAL STATEMENTS

31 DESEMBER 2011 DAN 2010

31 DECEMBER 2011 AND 2010

D A F T A R I S I C O N T E N T S Pernyataan Direksi Directors Statement Laporan Auditor Independen Independent Auditors Report Ekshibit/ Exhibit Laporan Posisi Keuangan Konsolidasian A Consolidated Statements of Financial Position Laporan Laba Rugi Komprehensif Konsolidasian B Consolidated Statements of Comprehensive Income Laporan Perubahan Ekuitas Konsolidasian C Consolidated Statements of Changes in Equity Laporan Arus Kas Konsolidasian D Consolidated Statements of Cash Flows Catatan atas Laporan Keuangan Konsolidasian E Notes to Consolidated Financial Statements

These Consolidated Financial Statements are Originally Issued In Indonesian Language

Ekshibit A Exhibit A

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK LAPORAN POSISI KEUANGAN KONSOLIDASIAN 31 DESEMBER 2011, 31 DESEMBER 2010 DAN

1 JANUARI 2010/ 31 DESEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain)

PT SIERAD PRODUCE Tbk AND SUBSIDIARIES CONSOLIDATED STATEMENTS OF FINANCIAL POSITION

31 DECEMBER 2011 AND 31 DECEMBER 2010 AND 1 JANUARY 2010/ 31 DECEMBER 2009

(Expressed in Rupiah, unless otherwise stated)

Catatan/ Notes

31 Des/Dec 2011

31 Des/Dec 2010

1 Jan 2010/ 31 Des 2009/ 1 Jan 2010/ 31 Dec 2009

A S E T A S S E T S Kas dan setara kas 2c,d,5 50.729.456.147 36.334.443.271 20.063.628.103 Cash and cash equivalents Piutang usaha - setelah Trade receivables - net of

dikurangi penyisihan allowance for impairment penurunan nilai sebesar losses amounted to Rp 136.008.198.082 Rp 136,008,198,082 (2010: Rp 133.297.182.419; (2010: Rp 133,297,182,419; 2009: Rp 126.052.725.268) 2e,f,6 326.581.346.321 368.521.453.160 341.717.086.921 2009: Rp 126,052,725,268)

Piutang lain-lain 2f,7 25.673.445.000 19.913.572.235 22.906.508.222 Other receivables Persediaan 2h,8 552.632.653.553 467.297.522.768 333.016.737.038 Inventories Hewan ternak produksi -

berumur pendek 2i,9 146.576.797.945 75.922.250.072 66.525.532.387 Livestock Beban dibayar di muka 2g 22.194.953.982 36.084.873.437 8.174.877.067 Prepaid expenses Pajak dibayar di muka 2r,10 1.215.920.916 7.023.663.756 11.084.414.313 Prepaid taxes Uang muka pembelian 11 103.723.999.774 55.600.234.079 56.049.108.736 Advance purchases

Jumlah Aset Lancar 1.229.328.573.638 1.066.698.012.778 859.537.892.787 Total Current Assets ASET TIDAK LANCAR NON-CURRENT ASSETS Investasi pada perusahaan

Asosiasi 2b,12 - - - Investment in associate Investasi jangka panjang Other long-term investments -

lainnya bersih 2b,13 - - - Net Piutang pihak-pihak berelasi 2f,w,36 26.517.171.665 30.916.515.935 39.596.515.935 Due from related parties Aset pajak tangguhan 2r,14b 28.784.777.526 27.720.644.748 39.941.534.065 Deferred tax assets Property, plant and Aset tetap - setelah dikurangi equipment net of

akumulasi penyusutan accumulated depreciation sebesar amounted to Rp 601.959.454.539 (2010: Rp 601,959,454,539 (2010: Rp 482.675.676.137; 2009: Rp 482,675,676,137; Rp 443.387.060.387) 2j,l,m,o,15 1.272.861.185.548 853.609.651.000 647.320.130.771 2009: Rp 443,387,060,387)

Advance for purchase of Uang muka pembelian aset property, plant and

tetap 7.963.184.588 43.561.741.087 44.159.232.253 equipment Tagihan pajak penghasilan 2r,17 24.294.684.047 4.823.649.648 - Claims for tax refund Goodwill 2b,4,18 10.890.455.260 - - Goodwill Aset tidak berwujud lainnya 2n,19 34.723.691.462 - - Other intangible assets Aset tetap yang tidak

digunakan 2k,16 4.780.847.749 8.798.565.454 10.199.808.346 Unutilized assets Uang jaminan yang dapat

diterima kembali 1.458.360.677 1.329.802.318 540.025.817 Refundable deposits Jumlah Aset Tidak Lancar 1.412.274.358.522 970.760.570.190 781.757.247.187 Total Non-Current Assets JUMLAH ASET 2.641.602.932.160 2.037.458.582.968 1.641.295.139.974 TOTAL ASSETS

Lihat Catatan atas Laporan Keuangan Konsolidasian pada Ekshibit E yang merupakan bagian yang tidak terpisahkan dari Laporan Keuangan Konsolidasian secara keseluruhan

See accompanying Notes to Consolidated Financial Statements on Exhibit E which are an integral part of

the Consolidated Financial Statements taken as a whole

These Consolidated Financial Statements are Originally Issued In Indonesian Language

Ekshibit A Exhibit A

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK LAPORAN POSISI KEUANGAN KONSOLIDASIAN 31 DESEMBER 2011, 31 DESEMBER 2010 DAN

1 JANUARI 2010/ 31 DESEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain)

PT SIERAD PRODUCE Tbk AND SUBSIDIARIES CONSOLIDATED STATEMENTS OF FINANCIAL POSITION

31 DECEMBER 2011 AND 31 DECEMBER 2010 AND 1 JANUARY 2010/ 31 DECEMBER 2009

(Expressed in Rupiah, unless otherwise stated)

Catatan/ Notes

31 Des/Dec 2011

31 Des/Dec 2010

1 Jan 2010/ 31 Des 2009/ 1 Jan 2010/ 31 Dec 2009

A S E T A S S E T S Kas dan setara kas 2c,d,5 50.729.456.147 36.334.443.271 20.063.628.103 Cash and cash equivalents Piutang usaha - setelah Trade receivables - net of

dikurangi penyisihan allowance for impairment penurunan nilai sebesar losses amounted to Rp 136.008.198.082 Rp 136,008,198,082 (2010: Rp 133.297.182.419; (2010: Rp 133,297,182,419; 2009: Rp 126.052.725.268) 2e,f,6 326.581.346.321 368.521.453.160 341.717.086.921 2009: Rp 126,052,725,268)

Piutang lain-lain 2f,7 25.673.445.000 19.913.572.235 22.906.508.222 Other receivables Persediaan 2h,8 552.632.653.553 467.297.522.768 333.016.737.038 Inventories Hewan ternak produksi -

berumur pendek 2i,9 146.576.797.945 75.922.250.072 66.525.532.387 Livestock Beban dibayar di muka 2g 22.194.953.982 36.084.873.437 8.174.877.067 Prepaid expenses Pajak dibayar di muka 2r,10 1.215.920.916 7.023.663.756 11.084.414.313 Prepaid taxes Uang muka pembelian 11 103.723.999.774 55.600.234.079 56.049.108.736 Advance purchases

Jumlah Aset Lancar 1.229.328.573.638 1.066.698.012.778 859.537.892.787 Total Current Assets ASET TIDAK LANCAR NON-CURRENT ASSETS Investasi pada perusahaan

Asosiasi 2b,12 - - - Investment in associate Investasi jangka panjang Other long-term investments -

lainnya bersih 2b,13 - - - Net Piutang pihak-pihak berelasi 2f,w,36 26.517.171.665 30.916.515.935 39.596.515.935 Due from related parties Aset pajak tangguhan 2r,14b 28.784.777.526 27.720.644.748 39.941.534.065 Deferred tax assets Property, plant and Aset tetap - setelah dikurangi equipment net of

akumulasi penyusutan accumulated depreciation sebesar amounted to Rp 601.959.454.539 (2010: Rp 601,959,454,539 (2010: Rp 482.675.676.137; 2009: Rp 482,675,676,137; Rp 443.387.060.387) 2j,l,m,o,15 1.272.861.185.548 853.609.651.000 647.320.130.771 2009: Rp 443,387,060,387)

Advance for purchase of Uang muka pembelian aset property, plant and

tetap 7.963.184.588 43.561.741.087 44.159.232.253 equipment Tagihan pajak penghasilan 2r,17 24.294.684.047 4.823.649.648 - Claims for tax refund Goodwill 2b,4,18 10.890.455.260 - - Goodwill Aset tidak berwujud lainnya 2n,19 34.723.691.462 - - Other intangible assets Aset tetap yang tidak

digunakan 2k,16 4.780.847.749 8.798.565.454 10.199.808.346 Unutilized assets Uang jaminan yang dapat

diterima kembali 1.458.360.677 1.329.802.318 540.025.817 Refundable deposits Jumlah Aset Tidak Lancar 1.412.274.358.522 970.760.570.190 781.757.247.187 Total Non-Current Assets JUMLAH ASET 2.641.602.932.160 2.037.458.582.968 1.641.295.139.974 TOTAL ASSETS

Lihat Catatan atas Laporan Keuangan Konsolidasian pada Ekshibit E yang merupakan bagian yang tidak terpisahkan dari Laporan Keuangan Konsolidasian secara keseluruhan

See accompanying Notes to Consolidated Financial Statements on Exhibit E which are an integral part of

the Consolidated Financial Statements taken as a whole

These Consolidated Financial Statements are Originally Issued In Indonesian Language

Ekshibit A/2 Exhibit A/2

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK LAPORAN POSISI KEUANGAN KONSOLIDASIAN 31 DESEMBER 2011, 31 DESEMBER 2010 DAN

1 JANUARI 2010/ 31 DESEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain)

PT SIERAD PRODUCE Tbk AND SUBSIDIARIES CONSOLIDATED STATEMENTS OF FINANCIAL POSITION

31 DECEMBER 2011 AND 31 DECEMBER 2010 AND 1 JANUARY 2010/ 31 DECEMBER 2009

(Expressed in Rupiah, unless otherwise stated)

Catatan/ Notes

31 Des/Dec 2011

31 Des/Dec 2010

1 Jan 2010/ 31 Des 2009/ 1 Jan 2010/ 31 Dec 2009

LIABILITAS DAN EKUITAS LIABILITIES AND EQUITY LIABILITAS JANGKA PENDEK CURRENT LIABILITIES Utang bank jangka pendek 2f,22 424.461.825.760 320.475.300.399 266.823.919.030 Short-term bank loans Utang murabahah jangka Short-term murabahah

pendek 2s,24 83.000.000.000 30.000.000.000 - payables Utang usaha - pihak ketiga 2f,20 202.976.869.279 119.823.760.772 117.710.972.592 Trade payables - third parties Beban yang masih harus

dibayar 2f,21 25.786.073.067 38.895.664.257 10.995.641.242 Accrued expenses Utang pajak 2r,14c 4.288.493.411 5.110.428.254 7.518.197.196 Taxes payable Utang dividen 145.445.205 - - Dividend payable Liabilitas lancar lainnya 27.339.935.286 29.603.441.638 17.423.424.825 Other current liabilities Liabilitas jangka panjang

yang jatuh tempo dalam Current maturities of waktu satu tahun : long-term liabilities: Utang bank 2f,23 106.371.250.161 13.753.102.407 2.152.000.000 Bank loans Utang murabahah 2s,24 7.370.172.720 4.299.223.278 - Murabahah payables Utang sewa pembiayaan 2l,25 909.435.703 2.094.693.120 2.688.601.903 Finance lease payable

Jumlah Liabilitas Jangka

Pendek

882.649.500.592

564.055.614.125

425.312.756.788

Total Current Liabilities LIABILITAS JANGKA

PANJANG

NON-CURRENT LIABILITIES Liabilitas pajak tangguhan 2r,14b 1.340.350.359 101.035.464 84.322.770 Deferred tax liabilities Provision for employee Liabilitas imbalan kerja 2t,26 50.448.309.706 28.855.676.078 24.176.107.213 benefits Liabilitas jangka panjang

setelah dikurangi bagian yang jatuh tempo dalam Long-term liabilities net of waktu satu tahun: current maturities: Utang bank 2f,23 402.033.260.018 185.308.897.124 9.824.855.150 Bank loans Utang murabahah 2s,24 33.627.909.370 24.741.410.642 - Murabahah payables Utang sewa pembiayaan 2l,25 431.200.000 1.384.473.678 3.052.737.396 Finance lease payable

Jumlah Liabilitas Jangka

Panjang

487.881.029.453

240.391.492.986

37.138.022.529 Total Non-Current

Liabilities JUMLAH LIABILITAS 1.370.530.530.045 804.447.107.111 462.450.779.317 TOTAL LIABILITIES

Lihat Catatan atas Laporan Keuangan Konsolidasian pada Ekshibit E yang merupakan bagian yang tidak terpisahkan dari Laporan Keuangan Konsolidasian secara keseluruhan

See accompanying Notes to Consolidated Financial Statements on Exhibit E which are an integral part of

the Consolidated Financial Statements taken as a whole

These Consolidated Financial Statements are Originally Issued In Indonesian Language

Ekshibit A/3 Exhibit A/3

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK LAPORAN POSISI KEUANGAN KONSOLIDASIAN 31 DESEMBER 2011, 31 DESEMBER 2010 DAN

1 JANUARI 2010/ 31 DESEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain)

PT SIERAD PRODUCE Tbk AND SUBSIDIARIES CONSOLIDATED STATEMENTS OF FINANCIAL POSITION

31 DECEMBER 2011 AND 31 DECEMBER 2010 AND 1 JANUARY 2010/ 31 DECEMBER 2009

(Expressed in Rupiah, unless otherwise stated)

Catatan/ Notes

31 Des/Dec 2011

31 Des/Dec 2010

1 Jan 2010/ 31 Des 2009/ 1 Jan 2010/ 31 Dec 2009

EKUITAS EQUITY Ekuitas yang diatribusikan kepada

Equity attributable to pemilik entitas induk the owners of the parent

Modal saham Share Capital Authorized capital:

73,099,900 shares of Modal dasar: 73.099.900 Series A with nominal

saham seri A nominal value Rp 395 (2009: Rp 395 (2009: Rp 5.000) Rp 5,000) per share, per saham, 650.686.609 650,686,609 shares of saham seri B nominal series B with nominal Rp 395 (2009: Rp 3.000) value Rp 395 per saham dan (2009: Rp 3,000) per share 65.140.785.747 saham and 65,140,785,747 shares Seri C nominal Rp 100 per of series C with nominal saham value Rp 100 per share

Ditempatkan dan disetor Issued and fully paid penuh 73.099.900 saham 73,099,900 shares of seri A, 650.686.609 series A, 650,686,609 saham seri B dan shares of series B and 8.667.321.984 saham 8,667,321,984 shares seri C 1d,27,41 1.152.627.869.455 1.152.627.869.455 3.184.291.525.400 of series C

Penurunan nilai nominal Reduction of share par saham sehubungan kuasi- value resulting from reorganisasi 2v,41 - - ( 2.031.663.655.945 ) quasi-reorganization

Tambahan modal disetor Additional paid-in capital - Bersih 28 756.839 756.839 756.839 - Net

Saldo laba Retained earnings Telah ditentukan

penggunaannya 29 3.057.415.309 - - Appropriated Belum ditentukan

penggunaannya 89.813.808.282 80.194.512.997 26.032.049.687 Unappropriated Ekuitas yang diatribusikan

kepada pemilik entitas Equity attributable to Induk 1.245.499.849.885 1.232.823.139.291 1.178.660.675.981 the owners of the parent

Kepentingan non -

pengendali

25.572.552.230

188.336.566

183.684.676 Non - controlling

interest Jumlah Ekuitas 1.271.072.402.115 1.233.011.475.857 1.178.844.360.657 Total Equity JUMLAH LIABILITAS DAN TOTAL LIABILITIES AND

EKUITAS 2.641.602.932.160 2.037.458.582.968 1.641.295.139.974 EQUITY

Lihat Catatan atas Laporan Keuangan Konsolidasian pada Ekshibit E yang merupakan bagian yang tidak terpisahkan dari Laporan Keuangan Konsolidasian secara keseluruhan

See accompanying Notes to Consolidated Financial Statements on Exhibit E which are an integral part of

the Consolidated Financial Statements taken as a whole

Ekshibit B/2 Exhibit B/2

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES LAPORAN LABA RUGI KOMPREHENSIF KONSOLIDASIAN CONSOLIDATED STATEMENTS OF COMPREHENSIVE INCOME TAHUN YANG BERAKHIR 31 DESEMBER 2011 DAN 2010

(Disajikan dalam Rupiah, kecuali dinyatakan lain) YEARS ENDED 31 DECEMBER 2011 AND 2010

(Expressed in Rupiah, unless otherwise stated)

Catatan/ 2 0 1 1 Notes 2 0 1 0 Jumlah laba/ pendapatan

komprehensif yang diatribusikan kepada:

Profit/ total comprehensive income

attributable to: Pemilik entitas induk 22.067.819.087 61.148.306.170 Owners of the Parent Kepentingan non-pengendali 1.384.447.377 12.057.704 Non-controlling interests

Jumlah 23.452.266.464 61.160.363.874 Total LABA PER SAHAM DASAR 2,35 35 6,51 BASIC EARNINGS PER SHARE

Lihat Catatan atas Laporan Keuangan Konsolidasian pada Ekshibit E terlampir yang merupakan bagian tak terpisahkan

dari Laporan Keuangan Konsolidasian secara keseluruhan

See accompanying Notes to Consolidated Financial Statements on Exhibit E which are an integral part of

the Consolidated Financial Statements taken as a whole

Ekshibit B Exhibit B

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES LAPORAN LABA RUGI KOMPREHENSIF KONSOLIDASIAN CONSOLIDATED STATEMENTS OF COMPREHENSIVE INCOME TAHUN YANG BERAKHIR 31 DESEMBER 2011 DAN 2010

(Disajikan dalam Rupiah, kecuali dinyatakan lain) YEARS ENDED 31 DECEMBER 2011 AND 2010

(Expressed in Rupiah, unless otherwise stated)

Catatan/ 2 0 1 1 Notes 2 0 1 0 PENJUALAN BERSIH 4.029.131.023.628 2p,30 3.642.500.860.349 NET SALES BEBAN POKOK PENJUALAN 3.607.549.568.193 2p,31 3.291.055.163.693 COST OF GOODS SOLD LABA KOTOR 421.581.455.435 351.445.696.656 GROSS PROFIT BEBAN USAHA OPERATING EXPENSES Beban penjualan 97.668.332.959 2p,32 64.530.310.152 Selling expenses Beban umum dan administrasi 194.490.160.635 2p,33 146.734.560.131 General and administrative expenses Jumlah Beban Usaha 292.158.493.594 211.264.870.283 Total Operating Expenses LABA USAHA 129.422.961.841 140.180.826.373 PROFIT FROM OPERATIONS PENGHASILAN (BEBAN) LAIN-LAIN OTHER INCOME (CHARGES) Rugi (laba) selisih kurs - bersih ( 15.995.754.104 ) 476.708.446 Loss (gain) on foreign exchange net Penjualan lain-lain 3.429.639.826 34 2.588.376.731 Sales of scraps Kerugian selisih perhitungan dan

perolehan persediaan ( 252.497.592 )

2h

( 3.745.561.830

)

Loss on stocktaking difference and inventories acquisition

Pendapatan keuangan 370.547.639 195.172.705 Finance income Penggantian klaim dan asuransi 1.380.046.542 7.216.071.501 Income from claim and insurance Laba penjualan aset tetap

152.744.875

15

347.461.133

Gain on sale of property, plant and equipment

Beban keuangan ( 87.790.617.495 ) ( 48.767.869.899 ) Finance expense Beban penghapusan langsung dan

penyisihan kerugian penurunan nilai piutang ( 6.455.236.391 )

2f,6

( 10.205.614.072 ) Provision for impairment losses on

trade receivables Keuntungan selisih pembayaran 908.701.818 178.912.948 Gain on difference in payments Lain-lain - bersih 8.842.364.139 4.656.870.730 Others - net Beban Lain-Lain - Bersih ( 95.410.060.743 ) ( 47.059.471.607 ) Other Charges - Net

LABA SEBELUM PAJAK PENGHASILAN

34.012.901.098

93.121.354.766 PROFIT BEFORE INCOME TAX EXPENSES

BEBAN PAJAK PENGHASILAN INCOME TAX EXPENSES Kini ( 10.209.592.415 ) 2r,14a ( 17.975.076.975 ) Current Tangguhan ( 351.042.219 ) 2r,14b ( 13.985.913.917 ) Deferred Jumlah Beban Pajak Penghasilan ( 10.560.634.634 ) ( 31.960.990.892 ) Total Income Tax Expense LABA USAHA TAHUN BERJALAN 23.452.266.464 61.160.363.874 PROFIT FOR THE YEAR PENDAPATAN KOMPREHENSIF LAIN

SETELAH PAJAK

-

- OTHER COMPREHENSIVE INCOME

NET OF TAX

JUMLAH PENDAPATAN KOMPREHENSIF TAHUN BERJALAN

23.452.266.464

61.160.363.874

TOTAL COMPREHENSIVE INCOME

FOR THE YEAR

Ekshibit B/2 Exhibit B/2

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES LAPORAN LABA RUGI KOMPREHENSIF KONSOLIDASIAN CONSOLIDATED STATEMENTS OF COMPREHENSIVE INCOME TAHUN YANG BERAKHIR 31 DESEMBER 2011 DAN 2010

(Disajikan dalam Rupiah, kecuali dinyatakan lain) YEARS ENDED 31 DECEMBER 2011 AND 2010

(Expressed in Rupiah, unless otherwise stated)

Catatan/ 2 0 1 1 Notes 2 0 1 0 Jumlah laba/ pendapatan

komprehensif yang diatribusikan kepada:

Profit/ total comprehensive income

attributable to: Pemilik entitas induk 22.067.819.087 61.148.306.170 Owners of the Parent Kepentingan non-pengendali 1.384.447.377 12.057.704 Non-controlling interests

Jumlah 23.452.266.464 61.160.363.874 Total LABA PER SAHAM DASAR 2,35 35 6,51 BASIC EARNINGS PER SHARE

Lihat Catatan atas Laporan Keuangan Konsolidasian pada Ekshibit E terlampir yang merupakan bagian tak terpisahkan

dari Laporan Keuangan Konsolidasian secara keseluruhan

See accompanying Notes to Consolidated Financial Statements on Exhibit E which are an integral part of

the Consolidated Financial Statements taken as a whole

These Consolidated Financial Statements are originally issued In Indonesian language

Ekshibit D Exhibit D

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES LAPORAN ARUS KAS KONSOLIDASIAN CONSOLIDATED STATEMENTS OF CASH FLOWS

TAHUN YANG BERAKHIR 31 DESEMBER 2011 DAN 2010 (Disajikan dalam Rupiah, kecuali dinyatakan lain)

YEAR ENDED 31 DECEMBER 2011 AND 2010 (Expressed in Rupiah, unless otherwise stated)

2 0 1 1 2 0 1 0 CASH FLOWS FROM OPERATING ARUS KAS DARI AKTIVITAS OPERASI ACTIVITES Penerimaan kas dari pelanggan 4.014.015.493.801 3.608.538.946.736 Cash received from customers Pembayaran kas kepada pemasok dan pihak Cash paid to suppliers and

ketiga lainnya ( 3.677.367.327.753 ) ( 3.395.566.180.796 ) other third parties Pembayaran kepada karyawan ( 162.831.900.779 ) ( 120.315.331.102 ) Cash paid to employees Pembayaran pajak - bersih ( 68.413.849.852 ) ( 46.908.510.801 ) Tax payments net Penerimaan hasil restitusi pajak 654.017.672 7.266.238.517 Cash received from tax refunds Penerimaan bunga 370.547.639 206.634.216 Interest received Pembayaran bunga ( 83.962.312.421 ) ( 45.739.422.652 ) Interest payments Kas bersih diperoleh dari aktivitas operasi 22.464.668.307 7.482.374.118

Net cash flows provided by operating activities

CASH FLOWS FROM INVESTING ARUS KAS DARI AKTIVITAS INVESTASI ACTIVITIES Penjualan aset tetap 569.479.685 1.455.801.333 Sale of property, plant and equipment Perolehan aset tetap

( 379.775.031.807

) ( 259.039.243.767

)

Acquisition of property, plant and equipment

Kas bersih digunakan untuk aktivitas

investasi (

379.205.552.122

) (

257.583.442.434

)

Net cash flows used for investing activities

CASH FLOWS FROM FINANCING ARUS KAS DARI AKTIVITAS PENDANAAN ACTIVITIES Penerimaan pinjaman bank 7.954.364.352.582 6.263.225.858.391 Cash received from bank loans Pembayaran utang bank dan utang sewa

pembiayaan ( 7.579.965.366.527

) ( 6.005.533.974.907

)

Payments of bank loans and financing leases

Pembayaran dividen ( 9.212.449.313 ) - Dividen payment Penerimaan dari Cash received from

pihak-pihak berelasi 4.399.344.270 8.680.000.000 related parties Kas bersih diperoleh dari aktivitas Net cash flows provided by financing

pendanaan 369.585.881.012 266.371.883.484 activities KENAIKAN BERSIH KAS

DAN SETARA KAS

12.844.997.197

16.270.815.168 NET lNCREASE IN CASH

AND CASH EQUIVALENTS KAS DAN SETARA KAS AKUISISI ENTITAS

ANAK

1.550.015.679

- CASH AND CASH EQUIVALENT

ACQUISITION OF A SUBSIDIARY KAS DAN SETARA KAS PADA AWAL TAHUN

36.334.443.271

20.063.628.103

CASH AND CASH EQUIVALENTS AT BEGINNING OF THE YEAR

KAS DAN SETARA KAS PADA AKHIR TAHUN

50.729.456.147

36.334.443.271

CASH AND CASH EQUIVALENTS AT END OF THE YEAR

These Consolidated Financial Statem

ents are originally Issued In Indonesian language

Ekshibit C

Exhibit C

PT SIERAD

PROD

UCE Tbk D

AN

ENTITA

S ANA

K

PT SIER

AD PR

OD

UCE T

bk AND

SUBSID

IARIES LA

PORA

N PERU

BAH

AN

EKUITA

S KON

SOLID

ASIAN

CON

SOLID

ATED

STAT

EMEN

TS O

F CHAN

GES IN

EQU

ITY

TA

HU

N YA

NG

BERAKH

IR 31 DESEM

BER 2011 DA

N 2010

Y

EARS ENDED

31 DECEM

BER 2011 AN

D 2010

(Disajikan dalam

Rupiah, kecuali dinyatakan lain)

(Expressed in Rupiah, unless otherw

ise stated)

Penurunan nilai

saham

Modal saham

sehubungan

Ekuitas yang

ditempatkan

Tam

bahan

kuasi-

diatribusikan

dan disetor

modal

reorganisasi/

kepada pem

ilik

Kepentingan

penuh/

disetor -

Reduction of

Saldo Laba/ Retained Earnings

entitas induk/

Non-

Capital

Bersih/

share

Telah

Belum

Equity

Pengendali/

stock issued

A

dditional

value resulting

Ditentukan

D

itentukan

attributable to

Non-

Ekuitas -

Catatan/

and fully

paid-in

from quasi-

Penggunaannya/ Penggunaannya/ the ow

ners of

Controlling

bersih/

Notes

paid

capital - Net

reorganization

Appropriated U

nappropriated the p

arent

Interests

Equity N

et

Saldo 1 Januari 2010

3.184.291.525.400

756.839 (

2.031.663.655.945 )

-

26.032.049.687

1.178.660.675.981

183.684.676

1.178.844.360.657

Balance as of 1 January 2010

Penurunan nilai agio saham

dan nominal saham

41 ( 2.031.663.655.945 )

-

2.031.663.655.945

-

-

-

-

-

Im

pairment of

additional paids in capital and par

value Penerapan aw

al PSAK 55 42

-

-

-

-

(

6.985.842.860 ) (

6.985.842.860

)

(

7.405.814 )

(

6.993.248.674 ) First tim

e adoption of SFAS 55

Laba komprehensif tahun

berjalan

-

-

-

-

61.148.306.170

61.148.306.170

12.057.704

61.160.363.874

Total comprehensive

income for the year

Saldo per 31 Desem

ber 2010

1.152.627.869.455

756.839 -

-

80.194.512.997

1.232.823.139.291

188.336.566

1.233.011.475.857 Balance as of

31 December 2010

Dividen

29

-

-

-

- (

9.391.108.493 ) ( 9.391.108.493 )

-

( 9.391.108.493 )

Dividend

Pembentukan cadangan um

um

29

-

-

-

3.057.415.309 (

3.057.415.309 )

-

-

-

A

ppropriation for general reserve

Perolehan entitas anak baru 4

-

-

-

-

-

- 24.041.826.829

24.041.826.829

Acquisition of new

Subsidiary

Penambahan m

odal saham

entitas anak oleh Perusahaan

-

-

-

-

-

-

( 42.058.542

) (

42.058.542 )

Issuance of additional shares of subsidiarys stock

by the Company

Laba komprehensif tahun

berjalan

-

-

-

-

22.067.819.087

22.067.819.087

1.384.447.377

23.452.266.464

Total comprehensive

income for the year

Saldo per 31 Desem

ber 2011

1.152.627.869.455

756.839 -

3.057.415.309

89.813.808.282

1.245.499.849.885

25.572.552.230

1.271.072.402.115 Balance as of

31 December 2011

Lihat Catatan atas Laporan Keuangan Konsolidasian

pada Ekshibit E terlampir yang m

erupakan bagian tak terpisahkan dari Laporan K

euangan Konsolidasian secara keseluruhan

See accom

panying Notes to Consolidated Financial Statem

ents on Exhibit E w

hich are an integral part of the Consolidated Financial Statem

ents taken as a whole

These Consolidated Financial Statements are originally issued In Indonesian language

Ekshibit D Exhibit D

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES LAPORAN ARUS KAS KONSOLIDASIAN CONSOLIDATED STATEMENTS OF CASH FLOWS

TAHUN YANG BERAKHIR 31 DESEMBER 2011 DAN 2010 (Disajikan dalam Rupiah, kecuali dinyatakan lain)

YEAR ENDED 31 DECEMBER 2011 AND 2010 (Expressed in Rupiah, unless otherwise stated)

2 0 1 1 2 0 1 0 CASH FLOWS FROM OPERATING ARUS KAS DARI AKTIVITAS OPERASI ACTIVITES Penerimaan kas dari pelanggan 4.014.015.493.801 3.608.538.946.736 Cash received from customers Pembayaran kas kepada pemasok dan pihak Cash paid to suppliers and

ketiga lainnya ( 3.677.367.327.753 ) ( 3.395.566.180.796 ) other third parties Pembayaran kepada karyawan ( 162.831.900.779 ) ( 120.315.331.102 ) Cash paid to employees Pembayaran pajak - bersih ( 68.413.849.852 ) ( 46.908.510.801 ) Tax payments net Penerimaan hasil restitusi pajak 654.017.672 7.266.238.517 Cash received from tax refunds Penerimaan bunga 370.547.639 206.634.216 Interest received Pembayaran bunga ( 83.962.312.421 ) ( 45.739.422.652 ) Interest payments Kas bersih diperoleh dari aktivitas operasi 22.464.668.307 7.482.374.118

Net cash flows provided by operating activities

CASH FLOWS FROM INVESTING ARUS KAS DARI AKTIVITAS INVESTASI ACTIVITIES Penjualan aset tetap 569.479.685 1.455.801.333 Sale of property, plant and equipment Perolehan aset tetap

( 379.775.031.807

) ( 259.039.243.767

)

Acquisition of property, plant and equipment

Kas bersih digunakan untuk aktivitas

investasi (

379.205.552.122

) (

257.583.442.434

)

Net cash flows used for investing activities

CASH FLOWS FROM FINANCING ARUS KAS DARI AKTIVITAS PENDANAAN ACTIVITIES Penerimaan pinjaman bank 7.954.364.352.582 6.263.225.858.391 Cash received from bank loans Pembayaran utang bank dan utang sewa

pembiayaan ( 7.579.965.366.527

) ( 6.005.533.974.907

)

Payments of bank loans and financing leases

Pembayaran dividen ( 9.212.449.313 ) - Dividen payment Penerimaan dari Cash received from

pihak-pihak berelasi 4.399.344.270 8.680.000.000 related parties Kas bersih diperoleh dari aktivitas Net cash flows provided by financing

pendanaan 369.585.881.012 266.371.883.484 activities KENAIKAN BERSIH KAS

DAN SETARA KAS

12.844.997.197

16.270.815.168 NET lNCREASE IN CASH

AND CASH EQUIVALENTS KAS DAN SETARA KAS AKUISISI ENTITAS

ANAK

1.550.015.679

- CASH AND CASH EQUIVALENT

ACQUISITION OF A SUBSIDIARY KAS DAN SETARA KAS PADA AWAL TAHUN

36.334.443.271

20.063.628.103

CASH AND CASH EQUIVALENTS AT BEGINNING OF THE YEAR

KAS DAN SETARA KAS PADA AKHIR TAHUN

50.729.456.147

36.334.443.271

CASH AND CASH EQUIVALENTS AT END OF THE YEAR

These Consolidated Financial Statements are originally Issued In Indonesian language

Ekshibit E Exhibit E

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

1. U M U M 1. G E N E R A L

a. Pendirian Perusahaan dan Informasi Umum a. Establishment and General Information

PT Sierad Produce Tbk (selanjutnya disebut Perusahaan) didirikan dengan akta Notaris No. 17 tanggal 6 September 1985 dari Raden Santoso, Notaris di Jakarta dan diubah dengan akta Notaris No. 27 tanggal 16 April 1986 dari Notaris yang sama.Anggaran dasar ini telah disahkan oleh Menteri Kehakiman Republik Indonesia dengan Surat Keputusan No. C2-4506.HT.01.01.TH.86 tanggal26 Juni 1986.

PT Sierad Produce Tbk (the Company) was established based on Notarial deed No. 17 dated 6 September 1985 of Raden Santoso, Notary in Jakarta, as amended by Notarial deed No. 27 dated 16 April 1986 of the same Notary. The Articles of Association was approved by the Minister of Justice of the Republic of lndonesia in his decree No. C2-4506.HT 01.01.TH.86 dated 26 June 1986.

Anggaran dasar Perusahaan telah mengalami beberapa kali perubahan, terakhir melalui akta Notaris No. 223 tanggal 22 Desember 2009 yang dibuat dihadapan Dr. Irawan Soerodjo, SH, MSi, Notaris di Jakarta, tentang persetujuan pelaksanaan kuasi-reorganisasi dan penurunan nilai nominal saham tanpa mengurangi jumlah saham beredar Perusahaan. Akta Notaris ini telah disahkan oleh Menteri Hukum dan Hak Asasi Manusia melalui surat keputusan No. AHU-11399.AH.01.02. Tahun 2010 pada tanggal 4 Maret 2010 (lihat Catatan 41).

The Company's Articles of Association had been amended several times, most recently on 22 December 2009, based on Notarial deed No. 223 made before Dr. lrawan Soerodjo, SH, MSi, a Notary in Jakarta, concerning the exercise of quasi-reorganization and reduction of shares par value without reducing amount of outstanding shares. This Notarial deed has been approved by the Minister of Justice and Human Rights of the Republic of Indonesia in his decree No. AHU 11399.AH.01.02. Year 2010 dated 4 March 2010 (see Note 41).

Sesuai dengan pasal 3 anggaran dasar Perusahaan, ruang lingkup kegiatan Perusahaan bergerak di bidang peternakan ayam bibit induk untuk menghasilkan ayam niaga, industri pemotongan dan pengolahan ayam terpadu dengan cold storage, industri pakan ternak dan industri pengeringan jagung.

In accordance with article 3 of the Company's Articles of Association, the Company's activities are to engage in the breeding of day old chicks, chicken slaughtering and integrated chicken processing with cold storage facility, poultry feed manufacturing and corn drying.

Kantor pusat Perusahaan terletak di Plaza City View, Kemang, Jakarta Selatan, dengan tempat usaha tersebar di Bogor, Sukabumi, Tangerang, Lampung, Sidoarjo dan Magelang. Hasil produksi dipasarkan di dalam negeri. Perusahaan mulai berproduksi secara komersial sejak tahun 1985.

The Company's head office is located at Plaza City View, Kemang, South Jakarta and its businesses are located in Bogor, Sukabumi, Tangerang, Lampung, Sidoarjo, and Magelang. Its products are marketed in domestic market. The Company started its commercial operations in 1985.

b. Dewan Komisaris, Dewan Direksi, Komite Audit dan

Karyawan b. Board of Commissioners, Board of Directors, Audit

Committee and Employees

Susunan anggota Dewan Komisaris dan Dewan Direksi Perusahaan pada tanggal 31 Desember 2011 dan 2010, adalah sebagai berikut:

A composition of the Companys Boards of Commissioners and Board of Directors as of 31 December 2011 and 2010 is as follows:

2 0 1 1 2 0 1 0 Dewan Komisaris Board of Commissioners Komisaris Utama President Commissioner

(Komisaris Independen) Antonius Joenoes Supit Antonius Joenoes Supit (Independent Commissioner) Komisaris (Independen) Djohan Effendi Djohan Effendi Commissioner (Independent) Komisaris Sri Lestari Anwar Sri Lestari Anwar Commissioner Dewan Direksi Board of Directors Direktur Utama : Budiardjo Tek Budiardjo Tek : President Director Wakil Direktur Utama Vice President Director

(Direktur tidak Terafiliasi) : Eko Putro Sandjojo Eko Putro Sandjojo : (Non Affiliated Director) Direktur : Sudirman Sudirman : Director Direktur : Fransiscus Xaverius Awi

Tantra Fransiscus Xaverius Awi

Tantra : Director

Direktur : Sik Wei Tjien Sik Wei Tjien : Director Direktur : - Roy Admadja : Director

Ekshibit D/2 Exhibit D/2

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES LAPORAN ARUS KAS KONSOLIDASIAN CONSOLIDATED STATEMENTS OF CASH FLOWS

TAHUN YANG BERAKHIR 31 DESEMBER 2011 DAN 2010 (Disajikan dalam Rupiah, kecuali dinyatakan lain)

YEAR ENDED 31 DECEMBER 2011 AND 2010 (Expressed in Rupiah, unless otherwise stated)

2 0 1 1 2 0 1 0 INFORMASI TAMBAHAN SUPPLEMENTIAL DISCLOSURES Kas dan setara kas pada akhir tahun terdiri dari:

cash and cash equivalents at end

of the year, consist of: K a s 1.738.290.289 1.247.678.577 Cash on hand B a n k 42.166.165.858 9.091.764.694 Cash in banks Deposito 6.825.000.000 25.995.000.000 Time deposit Jumlah 50.729.456.147 36.334.443.271 Total Aktivitas yang tidak mempengaruhi

arus kas

Activity not effecting to cash flows Penambahan aset tetap melalui sewa Additional of property, plant and

pembiayaan - 660.000.000 equipment under finance lease

Lihat Catatan atas Laporan Keuangan Konsolidasian pada Ekshibit E terlampir yang merupakan bagian tak terpisahkan

dari Laporan Keuangan Konsolidasian secara keseluruhan

See accompanying Notes to Consolidated Financial Statements on Exhibit E which are an integral part of

the Consolidated Financial Statements taken as a whole

These Consolidated Financial Statements are originally Issued In Indonesian language

Ekshibit E Exhibit E

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

1. U M U M 1. G E N E R A L

a. Pendirian Perusahaan dan Informasi Umum a. Establishment and General Information

PT Sierad Produce Tbk (selanjutnya disebut Perusahaan) didirikan dengan akta Notaris No. 17 tanggal 6 September 1985 dari Raden Santoso, Notaris di Jakarta dan diubah dengan akta Notaris No. 27 tanggal 16 April 1986 dari Notaris yang sama.Anggaran dasar ini telah disahkan oleh Menteri Kehakiman Republik Indonesia dengan Surat Keputusan No. C2-4506.HT.01.01.TH.86 tanggal26 Juni 1986.

PT Sierad Produce Tbk (the Company) was established based on Notarial deed No. 17 dated 6 September 1985 of Raden Santoso, Notary in Jakarta, as amended by Notarial deed No. 27 dated 16 April 1986 of the same Notary. The Articles of Association was approved by the Minister of Justice of the Republic of lndonesia in his decree No. C2-4506.HT 01.01.TH.86 dated 26 June 1986.

Anggaran dasar Perusahaan telah mengalami beberapa kali perubahan, terakhir melalui akta Notaris No. 223 tanggal 22 Desember 2009 yang dibuat dihadapan Dr. Irawan Soerodjo, SH, MSi, Notaris di Jakarta, tentang persetujuan pelaksanaan kuasi-reorganisasi dan penurunan nilai nominal saham tanpa mengurangi jumlah saham beredar Perusahaan. Akta Notaris ini telah disahkan oleh Menteri Hukum dan Hak Asasi Manusia melalui surat keputusan No. AHU-11399.AH.01.02. Tahun 2010 pada tanggal 4 Maret 2010 (lihat Catatan 41).

The Company's Articles of Association had been amended several times, most recently on 22 December 2009, based on Notarial deed No. 223 made before Dr. lrawan Soerodjo, SH, MSi, a Notary in Jakarta, concerning the exercise of quasi-reorganization and reduction of shares par value without reducing amount of outstanding shares. This Notarial deed has been approved by the Minister of Justice and Human Rights of the Republic of Indonesia in his decree No. AHU 11399.AH.01.02. Year 2010 dated 4 March 2010 (see Note 41).

Sesuai dengan pasal 3 anggaran dasar Perusahaan, ruang lingkup kegiatan Perusahaan bergerak di bidang peternakan ayam bibit induk untuk menghasilkan ayam niaga, industri pemotongan dan pengolahan ayam terpadu dengan cold storage, industri pakan ternak dan industri pengeringan jagung.

In accordance with article 3 of the Company's Articles of Association, the Company's activities are to engage in the breeding of day old chicks, chicken slaughtering and integrated chicken processing with cold storage facility, poultry feed manufacturing and corn drying.

Kantor pusat Perusahaan terletak di Plaza City View, Kemang, Jakarta Selatan, dengan tempat usaha tersebar di Bogor, Sukabumi, Tangerang, Lampung, Sidoarjo dan Magelang. Hasil produksi dipasarkan di dalam negeri. Perusahaan mulai berproduksi secara komersial sejak tahun 1985.

The Company's head office is located at Plaza City View, Kemang, South Jakarta and its businesses are located in Bogor, Sukabumi, Tangerang, Lampung, Sidoarjo, and Magelang. Its products are marketed in domestic market. The Company started its commercial operations in 1985.

b. Dewan Komisaris, Dewan Direksi, Komite Audit dan

Karyawan b. Board of Commissioners, Board of Directors, Audit

Committee and Employees

Susunan anggota Dewan Komisaris dan Dewan Direksi Perusahaan pada tanggal 31 Desember 2011 dan 2010, adalah sebagai berikut:

A composition of the Companys Boards of Commissioners and Board of Directors as of 31 December 2011 and 2010 is as follows:

2 0 1 1 2 0 1 0 Dewan Komisaris Board of Commissioners Komisaris Utama President Commissioner

(Komisaris Independen) Antonius Joenoes Supit Antonius Joenoes Supit (Independent Commissioner) Komisaris (Independen) Djohan Effendi Djohan Effendi Commissioner (Independent) Komisaris Sri Lestari Anwar Sri Lestari Anwar Commissioner Dewan Direksi Board of Directors Direktur Utama : Budiardjo Tek Budiardjo Tek : President Director Wakil Direktur Utama Vice President Director

(Direktur tidak Terafiliasi) : Eko Putro Sandjojo Eko Putro Sandjojo : (Non Affiliated Director) Direktur : Sudirman Sudirman : Director Direktur : Fransiscus Xaverius Awi

Tantra Fransiscus Xaverius Awi

Tantra : Director

Direktur : Sik Wei Tjien Sik Wei Tjien : Director Direktur : - Roy Admadja : Director

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/3 Exhibit E/3

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

1. U M U M (Lanjutan) 1. G E N E R A L (Continued)

c. Struktur Entitas anak (Lanjutan) c. Structure of Subsidiaries (Continued)

Persentase Pemilikan (langsung dan

tidak langsung)/ Tahun Percentage of operasi ownership komersial/ (direct and Year of Jumlah aset sebelum eliminasi/

Entitas anak/ Domisili/ Bidang usaha/ indirect) commercial Total assets before elimination Subsidiaries Domicile Business 2011 2010 operation 2 0 1 1 2 0 1 0

PT Transpasifik

Niagareksa Jakarta Perdagangan/

Trading 100,00% 100,00% 1995 6.249.425.538 6.840.481.539

PT Belfoods

Indonesia a) Bogor Industri pengolahan

makanan beku/ Frozen food processing industry

66,99% - 1993 138.292.784.706 -

a) Dikonsolidasi sejak Oktober 2011 a) Consolidated since October 2011

Pada tahun 2003, sesuai dengan pernyataan keputusan rapat pemegang saham PT Sierad Corporation (SC) dengan akta Notaris No. 25 tanggal 21 Oktober 2003 dari Notaris Diah Guntari Listianingsih Soemarwoto, SH, Notaris di Jakarta telah disetujui usulan direksi SC untuk melakukan penghentian kegiatan (operasional) SC dan melakukan tindakan hukum yang dianggap perlu dan penting untuk penghentian kegiatan (operasional) SC sesuai peraturan perundang-undangan yang berlaku di Indonesia. Sampai dengan tanggal penyelesaian laporan keuangan konsolidasian, belum ada rencana dari manajemen SC mengenai kelanjutan atas penghentian kegiatan (operasional) SC tersebut.

In 2003, based on the Shareholders' Minutes of Meeting of PT Sierad Corporation (SC) under Notarial deed No. 25 dated 21 October 2003, made before Diah Guntari Listianingsih Soemarwoto, SH, Notary in Jakarta, the Shareholders approved the Board of Directors of SC's proposal to discontinue the operational activities of SC and took necessary legal actions for the discontinuance of SC's operations in accordance with the rules and regulations applicable in Indonesia. Up to the date of completion of the consolidated financial statements, there had been no plan from SC's management concerning the discontinued operation of SC.

Menimbang bahwa aset, liabilitas, pendapatan serta beban SC pada tanggal 31 Desember 2011 dan 2010tidak material, tidak dilakukan pengungkapan terpisah dalam "Operasi dalam Penghentian" pada laporan keuangan konsolidasian sesuai dengan PSAK No. 58, mengenai "Operasi dalam Penghentian", juga pengungkapan terpisah tidak dilakukan oleh Perusahaan secara rinci dalam laporan laba rugi konsolidasian.

Considering the assets, liabilities, revenues, and expenses of SC as of 31 December 2011 and 2010 were not material, a separate presentation of "Discontinued Operations" is not presented in the consolidated financial statements in accordance with the PSAK No. 58, concerning "Discontinued Operations", and also no separate and detailed disclosure in the consolidated statement ofcomprehensive income.

Sampai dengan tanggal 31 Desember 2011, PT Sierad Pangan Nusantara, entitas anak, masih dalam tahap pengembangan, non-aktif dan pra-operasi, serta tidak ada transaksi yang signifikan dalam perusahaan tersebut. Sementara itu, PT Transpasifik Niagareksa, entitas anak, pada tahun 2008 sudah mulai beroperasi kembali.

Up to 31 December 2011, PT Sierad Pangan Nusantara, was still in development stage, inactive and pre-operating, and there were no significant transactions relating to the company. Meanwhile, PT Transpasifik Niagareksa, a subsidiary, during 2008 was started to operate.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/2 Exhibit E/2

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

1. U M U M (Lanjutan) 1. G E N E R A L (Continued)

b. Dewan Komisaris, Dewan Direksi, Komite Audit dan Karyawan (Lanjutan)

b. Board of Commissioners, Board of Directors, Audit Committee and Employees (Continued)

Susunan anggota Komite Audit pada tanggal 31 Desember 2011 dan 2010, adalah sebagai berikut:

The Audit Committee members as of 31 December 2011 and 2010 are as follows:

2 0 1 1 2 0 1 0 Komite Audit Audit Committee Ketua : Antonius Joenoes Supit Antonius Joenoes Supit : Chairman Anggota : Eman Achmad Sulaeman Eman Achmad Sulaeman : Member Anggota : Rodion Wikanto

Njotowidjojo Rodion Wikanto

Njotowidjojo : Member

Jumlah karyawan tetap Perusahaan dan Entitas anak pada tanggal 31 Desember 2011 dan 2010 adalah sejumlah 2.323 dan 1.866 karyawan (tidak diaudit).

As of 31 December 2011 and 2010, the permanent employees of the Company and its subsidiaries were 2,323 and 1,866 employees, respectively (unaudited).

Jumlah remunerasi yang diterima oleh karyawan kunci Perusahaan yang diterima selama tahun 2011 dan 2010 masing-masing sebesar Rp 1.669.531.780 dan Rp 1.318.597.122.

Total remuneration received by Companys key management personnel in 2011 and 2010 amounted to Rp 1,669,531,780 and Rp 1,318,597,122.

c. Struktur Entitas Anak c. Structure of Subsidiaries

Perusahaan memiliki baik secara langsung maupun tidak langsung lebih dari 50% saham entitas anak dan atau mempunyai kendali atas manajemen entitas anak sebagai berikut:

The Company has ownership interest of more than 50%, directly or indirectly, and/or has control over the management of the following subsidiaries:

Persentase Pemilikan (langsung dan

tidak langsung)/ Tahun Percentage of operasi ownership komersial/ (direct and Year of Jumlah aset sebelum eliminasi/

Entitas anak/ Domisili/ Bidang usaha/ indirect) commercial Total assets before elimination Subsidiaries Domicile Business 2011 2010 operation 2 0 1 1 2 0 1 0

PT Sierad Industries Jakarta Industri peralatan

peternakan ayam/ 99,54% 99,40% 1996 80.980.639.501 64.215.448.163

Poultry equipment industry

PT Dwipa Mina

Nusantara Bali Industri tepung ikan/ 100,00% 100,00% 1996 2.534.273.245 2.940.531.483

Fish meal industry

PT Sierad Pangan Nusantara

Jakarta Industri makanan dan minuman/

Food and beverage industry

100,00% 100,00% Pra-operasi/ Pre-

operations

376.763.296 7.495.176.821

PT Sierad Jakarta Distribusi dan 100,00% 100,00% Operasi 10.806.908.972 10.806.908.972

Corporation perdagangan peralatan peternakan ayam, bahan baku, pakan ternak dan produk lainnya/

dalam penghentian/ Discontinued

operation

Distribution and trading of poultry equipment, feedmill and others product

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/3 Exhibit E/3

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

1. U M U M (Lanjutan) 1. G E N E R A L (Continued)

c. Struktur Entitas anak (Lanjutan) c. Structure of Subsidiaries (Continued)

Persentase Pemilikan (langsung dan

tidak langsung)/ Tahun Percentage of operasi ownership komersial/ (direct and Year of Jumlah aset sebelum eliminasi/

Entitas anak/ Domisili/ Bidang usaha/ indirect) commercial Total assets before elimination Subsidiaries Domicile Business 2011 2010 operation 2 0 1 1 2 0 1 0

PT Transpasifik

Niagareksa Jakarta Perdagangan/

Trading 100,00% 100,00% 1995 6.249.425.538 6.840.481.539

PT Belfoods

Indonesia a) Bogor Industri pengolahan

makanan beku/ Frozen food processing industry

66,99% - 1993 138.292.784.706 -

a) Dikonsolidasi sejak Oktober 2011 a) Consolidated since October 2011

Pada tahun 2003, sesuai dengan pernyataan keputusan rapat pemegang saham PT Sierad Corporation (SC) dengan akta Notaris No. 25 tanggal 21 Oktober 2003 dari Notaris Diah Guntari Listianingsih Soemarwoto, SH, Notaris di Jakarta telah disetujui usulan direksi SC untuk melakukan penghentian kegiatan (operasional) SC dan melakukan tindakan hukum yang dianggap perlu dan penting untuk penghentian kegiatan (operasional) SC sesuai peraturan perundang-undangan yang berlaku di Indonesia. Sampai dengan tanggal penyelesaian laporan keuangan konsolidasian, belum ada rencana dari manajemen SC mengenai kelanjutan atas penghentian kegiatan (operasional) SC tersebut.

In 2003, based on the Shareholders' Minutes of Meeting of PT Sierad Corporation (SC) under Notarial deed No. 25 dated 21 October 2003, made before Diah Guntari Listianingsih Soemarwoto, SH, Notary in Jakarta, the Shareholders approved the Board of Directors of SC's proposal to discontinue the operational activities of SC and took necessary legal actions for the discontinuance of SC's operations in accordance with the rules and regulations applicable in Indonesia. Up to the date of completion of the consolidated financial statements, there had been no plan from SC's management concerning the discontinued operation of SC.

Menimbang bahwa aset, liabilitas, pendapatan serta beban SC pada tanggal 31 Desember 2011 dan 2010tidak material, tidak dilakukan pengungkapan terpisah dalam "Operasi dalam Penghentian" pada laporan keuangan konsolidasian sesuai dengan PSAK No. 58, mengenai "Operasi dalam Penghentian", juga pengungkapan terpisah tidak dilakukan oleh Perusahaan secara rinci dalam laporan laba rugi konsolidasian.

Considering the assets, liabilities, revenues, and expenses of SC as of 31 December 2011 and 2010 were not material, a separate presentation of "Discontinued Operations" is not presented in the consolidated financial statements in accordance with the PSAK No. 58, concerning "Discontinued Operations", and also no separate and detailed disclosure in the consolidated statement ofcomprehensive income.

Sampai dengan tanggal 31 Desember 2011, PT Sierad Pangan Nusantara, entitas anak, masih dalam tahap pengembangan, non-aktif dan pra-operasi, serta tidak ada transaksi yang signifikan dalam perusahaan tersebut. Sementara itu, PT Transpasifik Niagareksa, entitas anak, pada tahun 2008 sudah mulai beroperasi kembali.

Up to 31 December 2011, PT Sierad Pangan Nusantara, was still in development stage, inactive and pre-operating, and there were no significant transactions relating to the company. Meanwhile, PT Transpasifik Niagareksa, a subsidiary, during 2008 was started to operate.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/5 Exhibit E/5

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

1. U M U M (Lanjutan) 1. G E N E R A L (Continued)

d. Penawaran Umum Efek Perusahaan d. Public Offering of the Company's Stock

Pada tahun 2009, Perusahaan melaksanakan kuasi-reorganisasi yang diikuti dengan reorganisasi secarahukum dengan mengurangi nilai nominal saham tanpa mengurangi jumlah saham beredar (penurunan modal saham). Kuasi-reorganisasi Perusahaan telah disetujui para pemegang saham dalam Rapat Umum Pemegang Saham Luar Biasa pada tanggal 22 Desember 2009 yang didokumentasikan dalam akta Notaris No. 223 yang dibuat dihadapan Dr. Irawan Soerodjo, SH, MSi, Notaris di Jakarta (lihat Catatan 27 dan 41).

In 2009, the Company executed a quasi-reorganization which was followed by a legal reorganization through reduction of share par value without reducing outstanding shares amount (reduction of capital stock). The Company's quasi-reorganization was approved by shareholders during the Company's Extraordinary General Meeting of Shareholders Decision which was documented in Notarial deed No. 223 dated 22 December 2009 made before Dr. lrawan Soerodjo, SH, MSi, a Notary in Jakarta (see Notes 27 and 41).

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

a. Dasar Pengukuran dan Penyusunan Laporan Keuangan Konsolidasian

a. Basis of Preparation of the Consolidated Financial Statements

Laporan keuangan konsolidasian disajikan sesuai dengan Standar Akuntansi Keuangan Indonesia termasuk Peraturan Badan Pengawas Pasar Modal dan Lembaga Keuangan (Bapepam-LK) No. VIII.G.7 (Revisi 2000) tentang Pedoman Penyajian Laporan Keuangan.

These consolidated financial statements are prepared in conformity with Indonesia Financial Accounting Standards included Regulations of Capital Market and Supervisory Board (Bapepam-LK) No. VIII.G.7 (Revision 2000) regarding the Preparation of Financial Statements.

Laporan keuangan konsolidasian disusun berdasarkan konsep biaya perolehan (historical cost), kecuali untuk beberapa akun tertentu yang disusun berdasarkan pengukuran lain sebagaimana dijelaskan dalam kebijakan akuntansi masing-masing akun tersebut. Laporan keuangan konsolidasian disusun berdasarkan akuntansi berbasis akrual.

The consolidated financial statements have been prepared using the historical costs concept, except for certain accounts which have been prepared on the basis of other measurements as described in their respective policies. The consolidated financial statements are prepared under the accrual basis of accounting.

Laporan arus kas konsolidasian disajikan dengan metode langsung (direct method) dengan mengelompokkan arus kas dalam aktivitas operasi, investasi dan pendanaan.

The consolidated statements of cash flows are prepared using the direct method by classifying cash flows into operating, investing and financing activities.

Mata uang pelaporan yang digunakan dalam penyusunan laporan keuangan konsolidasian ini adalah Rupiah (Rp).

The reporting currency used in the preparation of the consolidated financial statements is the Indonesian Rupiah (Rp).

Adopsi PSAK Revisian Adoption of Revised PSAK

Kebijakan akuntansi yang diadopsi adalah konsisten dengan kebijakan akuntansi tahun buku sebelumnya, kecuali pada tahun buku yang bersangkutan, Grup mengadopsi seluruh PSAK dan ISAK yang baru maupun yang direvisi yang berlaku efektif pada awal atau setelah tanggal 1 Januari 2011. Perubahan pada kebijakan akuntansi Grup telah disesuaikan sebagaimana dipersyaratkan oleh ketentuan transisi yang relevan di dalam PSAK dan ISAK terkait.

Accounting policies adopted are consistent with those of the previous financial year, except that in the current financial year, the Group adopted all the new or revised PSAK and ISAK that are effective for annual periods beginning on or after 1 January 2011. Changes to the Group's accounting policies have been made as required, in accordance with the relevant transitional provisions in the respective PSAK and ISAK.

Berikut ini adalah PSAK revisian yang telah mengalami perubahan yang relevan terhadap penyusunan dan penyajian laporan keuangan Grup:

The following are the revised PSAK that are relevant to the Group:

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/4 Exhibit E/4

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

1. U M U M (Lanjutan) 1. G E N E R A L (Continued)

c. Struktur Entitas anak (Lanjutan) c. Structure of Subsidiaries (Continued)

Berdasarkan keputusan Rapat Umum Pemegang Saham Luar Biasa Perusahaan pada tanggal 30 Juni 2009, yang telah dituangkan dalam akta berita acara nomor 188, telah disetujui pengambilalihan (akuisisi) saham dalam PT Belfoods Indonesia (BI) sebanyak 596.806saham dengan harga saham Rp 100.000 per saham dengan cara konversi utang menjadi kepemilikan saham (debt to equity swap). Pengambil-alihan saham BI ini berlaku efektif setelah mendapat persetujuan dari para pemegang saham BI pada bulan Oktober 2011 (Catatan 4).

Based on deeds of Company's Extraordinary General Meeting of Shareholders decision No. 188 dated 30 June 2009, it was approved the acquisition of share in PT Belfoods Indonesia (BI) of 596,806 shares with share price of Rp 100,000 each, by converting debt into shares (debt to equity swap). The Bl's share acquisition will become effective after obtaining an approval from BIs shareholders in October 2011(Note 4).

Perusahaan bersama-sama entitas anak untuk selanjutnya disebut sebagai Grup

The Company together with its subsidiaries will be herein after referred as the Group

d. Penawaran Umum Efek Perusahaan d. Public Offering of the Company's Stock

Pada tanggal 29 Nopember 1996, Perusahaan memperoleh pernyataan efektif dari Ketua Badan Pengawas Pasar Modal (Bapepam) dengan suratnya No. S-1946/PM/1996 untuk melakukan penawaran umum atas 250.000.000 saham kepada masyarakat dengan nilai nominal Rp 500 per saham. Sejak saat itu, Perusahaan telah melakukan hal-hal sebagai berikut :

On 29 November 1996, the Company received an effective notification from the Chairman of the Capital Market Supervisory Agency (Bapepam) in his letter No. S-1946/PM/1996 concerning the public offering of 250,000,000 shares with par value of Rp 500 per share. Thereafter, the Company has done several actions as follows :

Jumlah saham beredar

setelah transaksi/ Tahun/ Keterangan/ Total shares outstanding

after transactions Year Description (Lembar / Share)

1997 Penerbitan 76.436.000 lembar saham seri A dengan nilai nominal Rp 500 dari

konversi obligasi/Issuance of 76,436,000 A series shares with par value of Rp 500 from the conversion of the bonds 726.436.000

1998 Konversi obligasi/Conversion of bonds 730.999.000 2001 Penerbitan saham seri B sejumlah 6.506.866.083 saham dengan nominal Rp 300,

sehingga saham beredar menjadi/Issuance of 6,506,866,083 B series shares with par value of Rp 300, therefore total outstanding shares are:

seri A/A series 730.999.000 seri B/B series 6.506.866.083 2004 Penggabungan saham (reversed stock) sebesar 10 kali, sehingga saham yang

beredar menjadi/Reversed stock split of 10 times, therefore the Companys shares are:

seri A/A series 73.099.900 seri B/B series 650.686.609 2005 Konversi Utang Obligasi Konversi dan Utang Jangka Panjang, sehingga saham yang

beredar menjadi/Conversion of convertible bonds and long-term loan, therefore the outstanding shares are:

seri A/A series 73.099.900 seri B/B series 650.686.609 seri C/C series 8.667.321.984

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/5 Exhibit E/5

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

1. U M U M (Lanjutan) 1. G E N E R A L (Continued)

d. Penawaran Umum Efek Perusahaan d. Public Offering of the Company's Stock

Pada tahun 2009, Perusahaan melaksanakan kuasi-reorganisasi yang diikuti dengan reorganisasi secarahukum dengan mengurangi nilai nominal saham tanpa mengurangi jumlah saham beredar (penurunan modal saham). Kuasi-reorganisasi Perusahaan telah disetujui para pemegang saham dalam Rapat Umum Pemegang Saham Luar Biasa pada tanggal 22 Desember 2009 yang didokumentasikan dalam akta Notaris No. 223 yang dibuat dihadapan Dr. Irawan Soerodjo, SH, MSi, Notaris di Jakarta (lihat Catatan 27 dan 41).

In 2009, the Company executed a quasi-reorganization which was followed by a legal reorganization through reduction of share par value without reducing outstanding shares amount (reduction of capital stock). The Company's quasi-reorganization was approved by shareholders during the Company's Extraordinary General Meeting of Shareholders Decision which was documented in Notarial deed No. 223 dated 22 December 2009 made before Dr. lrawan Soerodjo, SH, MSi, a Notary in Jakarta (see Notes 27 and 41).

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

a. Dasar Pengukuran dan Penyusunan Laporan Keuangan Konsolidasian

a. Basis of Preparation of the Consolidated Financial Statements

Laporan keuangan konsolidasian disajikan sesuai dengan Standar Akuntansi Keuangan Indonesia termasuk Peraturan Badan Pengawas Pasar Modal dan Lembaga Keuangan (Bapepam-LK) No. VIII.G.7 (Revisi 2000) tentang Pedoman Penyajian Laporan Keuangan.

These consolidated financial statements are prepared in conformity with Indonesia Financial Accounting Standards included Regulations of Capital Market and Supervisory Board (Bapepam-LK) No. VIII.G.7 (Revision 2000) regarding the Preparation of Financial Statements.

Laporan keuangan konsolidasian disusun berdasarkan konsep biaya perolehan (historical cost), kecuali untuk beberapa akun tertentu yang disusun berdasarkan pengukuran lain sebagaimana dijelaskan dalam kebijakan akuntansi masing-masing akun tersebut. Laporan keuangan konsolidasian disusun berdasarkan akuntansi berbasis akrual.

The consolidated financial statements have been prepared using the historical costs concept, except for certain accounts which have been prepared on the basis of other measurements as described in their respective policies. The consolidated financial statements are prepared under the accrual basis of accounting.

Laporan arus kas konsolidasian disajikan dengan metode langsung (direct method) dengan mengelompokkan arus kas dalam aktivitas operasi, investasi dan pendanaan.

The consolidated statements of cash flows are prepared using the direct method by classifying cash flows into operating, investing and financing activities.

Mata uang pelaporan yang digunakan dalam penyusunan laporan keuangan konsolidasian ini adalah Rupiah (Rp).

The reporting currency used in the preparation of the consolidated financial statements is the Indonesian Rupiah (Rp).

Adopsi PSAK Revisian Adoption of Revised PSAK

Kebijakan akuntansi yang diadopsi adalah konsisten dengan kebijakan akuntansi tahun buku sebelumnya, kecuali pada tahun buku yang bersangkutan, Grup mengadopsi seluruh PSAK dan ISAK yang baru maupun yang direvisi yang berlaku efektif pada awal atau setelah tanggal 1 Januari 2011. Perubahan pada kebijakan akuntansi Grup telah disesuaikan sebagaimana dipersyaratkan oleh ketentuan transisi yang relevan di dalam PSAK dan ISAK terkait.

Accounting policies adopted are consistent with those of the previous financial year, except that in the current financial year, the Group adopted all the new or revised PSAK and ISAK that are effective for annual periods beginning on or after 1 January 2011. Changes to the Group's accounting policies have been made as required, in accordance with the relevant transitional provisions in the respective PSAK and ISAK.

Berikut ini adalah PSAK revisian yang telah mengalami perubahan yang relevan terhadap penyusunan dan penyajian laporan keuangan Grup:

The following are the revised PSAK that are relevant to the Group:

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/7 Exhibit E/7

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

(Continued)

a. Dasar Pengukuran dan Penyusunan Laporan Keuangan Konsolidasian (Lanjutan)

a. Basis of Preparation of the Consolidated Financial Statements (Continued)

PSAK 4 (Revisi 2009), Laporan Keuangan Konsolidasian dan Laporan Keuangan Tersendiri(Lanjutan)

PSAK 4 (Revised 2009), Consolidated and Separate Financial Statements (Continued)

ii. Perubahan bagian kepemilikan yang bukan

merupakan hilangnya pengendalian, diperhitungkan sebagai transaksi ekuitas. Oleh karena itu, perubahan tersebut tidak memiliki dampak terhadap goodwill dan tidak menimbulkan laba atau rugi yang diakui dalam laporan laba rugi;

ii. A change in the ownership interest of a subsidiary that does not result in a loss of control is accounted for as an equity transaction. Therefore, such a change has no impact on goodwill, nor does it give rise to a gain or loss recognized in profit and loss;

iii. Pada saat pengendalian terhadap entitas anak

hilang, semua kepentingan yang dimiliki diukur pada nilai wajar dengan laba rugi yang diakui di dalam laporan laba rugi;

iii. When control over a subsidiary is lost, any interest retained is measured at fair value with the corresponding gain or loss recognized in profit and loss.

iv. Pertimbangan keberadaan dan dampak hak suara

potensial yang dapat dilaksanakan dan dikonversi, termasuk hak suara potensial yang dimiliki oleh entitas lain,di dalam penilaian pengendalian;

iv. Considerations for the existence and effect of potential voting rights that are currently exercisable or convertible, including potential voting rights held by another entity, in assessment of control.

v. Ketika entitas induk mengakuisisi entitas anak

sebelum tanggal 1 Januari 2011 yang bertujuan untuk dijual dalam jangka pendek dan entitas anak dengan pembatasan jangka panjang signifikan yang mempengaruhi kemampuan untuk mengalihkan dana kepada entitas induk, entitas induk harus mengkonsolidasikan entitas-entitas tersebut sesuai dengan PSAK 4 (R2009) secara prospektif.

v. When the parent entity have acquired subsidiaries before 1 January 2011 for the purpose of short-term disposal and subsidiaries with significant long-term restriction that affects the ability to transfer funds to the parent entity, the parent entity shall consolidate these entities in accordance with the PSAK 4 (Revised 2009) prospectively.

Adopsi PSAK 4 (Revisi 2009) tidak memiliki dampak material kepada laporan keuangan konsolidasian Grup dalam hal transaksi dengan kepentingan nonpengendali, yang diatribusikan kepada kerugian kepentingan nonpengendali dan pelepasan entitas anak sebelum tanggal 1 Januari 2011.

The adoption of the PSAK 4 (Revised 2009) has no material impact to the Groups consolidated financial statements in respect of transactions with non-controlling interests, attribution of losses to non-controlling interests and disposal of subsidiaries prior to 1 January 2011.

Informasi komparatif telah disajikan kembali dalam hal kepentingan nonpengendali yang disajikan sebagai bagian ekuitas. Dengan demikian kepatuhan terhadap standar revisian telah dicapai.

Comparative information has been re-presented with respect to non-controlling interest presented as part of equity, so that compliance with the revised standard is achieved.

PSAK 5 (Revisi 2009), Segmen Operasi PSAK 5 (Revised 2009), Operating Segment

Standar revisi ini menentukan dan menyajikan segmen operasi berdasarkan informasi yang digunakan oleh pengambil keputusan operasional Grup.

This revised standard determines and presents operating segments based on the information used by operational decision-making group.

Sebelumnya informasi segmen disajikan berdasarkan segmen usaha dan segmen geografis. Namun demikian, pengambil keputusan operasional Grup, tetap menggunakan basis yang sama yaitu berdasarkan sifat produk dan jasa. Pengaruh dari penerapan standar revisi ini terhadap penyusunan laporan keuangan konsolidasian tidak signifikan.

Previous segment information is presented based on business segments and geographical segments. However, the operational decision-making group, still using the same basis that is based on the nature of products and services. Effect of application of this revised standard on the consolidated financial statements was not significant.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/6 Exhibit E/6

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

(Continued)

a. Dasar Pengukuran dan Penyusunan Laporan Keuangan Konsolidasian (Lanjutan)

a. Basis of Preparation of the Consolidated Financial Statements (Continued)

PSAK 1 (R2009) Penyajian Laporan Keuangan/ Financial Statements Presentation PSAK 2 (R2009) Laporan Arus Kas/ Statement of Cash Flows PSAK 3 (R2010) Laporan Keuangan Interim/ Interim Financial Statements PSAK 4 (R2009) Laporan Keuangan Konsolidasian dan Laporan Keuangan Tersendiri/ Consolidated and Separate

Financial Statements PSAK 5 (R2009) Segmen Operasi/ Operating Segments PSAK 7 (2010) Pengungkapan Pihak-pihak Berelasi/ Related Party Disclosures PSAK 8 (R2010) Peristiwa Setelah Periode Pelaporan/ Events After the Reporting Period PSAK 15 (R2009) Investasi pada Entitas Asosiasi/ Investment in Associates PSAK 19 (R2010) Aset Tak Berwujud/ Intangible Assets PSAK 23 (R2010) Pendapatan/ Revenue PSAK 25 (R2009) Kebijakan Akuntansi, Perubahan Estimasi Akuntansi dan Kesalahan/ Accounting Policies, Changes in

Accounting Estimates and Errors PSAK 48 (R2009) Penurunan Nilai Aset/ Impairment of Assets PSAK 57 (R2009) Provisi, Liabilitas Kontinjensi, dan Aset Kontinjensi/ Provision, Contingent Liabilities and Contingent

Assets

Adopsi PSAK dan ISAK di atas, tidak memiliki dampak terhadap laporan keuangan konsolidasian Grup kecuali bagi PSAK dan ISAK berikut sebagaimana diungkapkan di bawah ini.

The adoption of the above PSAK and ISAK did not have any effect on the consolidated financial statements of the Group except for the following PSAK and ISAK as disclosed below.

PSAK 1 (Revisi 2009), Penyajian Laporan Keuangan

PSAK 1 (Revised 2009), Presentation of Financial Statements

Standar revisian memisahkan perubahan pemilik dan nonpemilik di dalam ekuitas. Laporan perubahan ekuitas hanya meliputi rincian transaksi dengan pemilik, dengan perubahan non pemilik di dalam ekuitas yang disajikan dalam rekonsiliasi tiap komponen ekuitas. Sebagai tambahan, standar memperkenalkan laporan laba rugi komprehensif: laporan laba rugi komprehensif semua item pendapatan dan beban yang diakui, baik dalam bentuk tunggal satu laporan, atau dalam dua laporan yang terkait. Grup memilih untuk menyajikan dalam bentuk laporan tunggal. Sebagai tambahan, laporan posisi keuangan disyaratkan pada awal periode komparatif paling awal yang diikuti dengan perubahan kebijakan akuntansi, koreksi kesalahan atau reklasifikasi item di dalam laporan keuangan. Informasi komparatif telah disajikan kembali, sehingga kepatuhan terhadap standar revisian dapat dicapai.

The revised standard separates owner and non-owner changes in equity. The statement of changes in equity includes only details of transactions with owners, with non-owners changes in equity presented in a reconciliation of each component of equity. In addition, the standard introduces the statement of comprehensive income: it presents all items of recognized income and expenses, either in one single statement, or in two linked statements. The Group has elected to present a single statement. In addition, a statement of financial position is required at the beginning of the earliest comparative period following a change in accounting policy, the correction of an error or the reclassification of items in the financial statements. Comparative information has been re-presented so that compliance with the revised standard is achieved.

PSAK 4 (Revisi 2009), Laporan Keuangan Konsolidasian dan Laporan Keuangan Tersendiri

PSAK 4 (Revised 2009), Consolidated and Separate Financial Statements

Berdasarkan ketentuan transisisi PSAK 4 (R2009), PSAK 4 revisian diterapkan secara retrospektif kecuali bagi perubahan kebijakan akuntansi signifikan berikut ini yang diterapkan secara prospektif:

According to its transitional provisions, the revised PSAK 4 has been applied retrospectively except for the following changes in significant accounting policies which have been applied prospectively:

i. Kerugian yang terjadi pada entitas anak,

dialokasikan kepada kepentingan nonpengendali, bahkan apabila kerugian tersebut melebihi kepemilikan kepentingan nonpengendali pada entitas anak;

i. Losses incurred by a subsidiary are allocated to the non-controlling interest even if the losses exceed the non-controlling interest in the subsidiarys equity.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/7 Exhibit E/7

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

(Continued)

a. Dasar Pengukuran dan Penyusunan Laporan Keuangan Konsolidasian (Lanjutan)

a. Basis of Preparation of the Consolidated Financial Statements (Continued)

PSAK 4 (Revisi 2009), Laporan Keuangan Konsolidasian dan Laporan Keuangan Tersendiri(Lanjutan)

PSAK 4 (Revised 2009), Consolidated and Separate Financial Statements (Continued)

ii. Perubahan bagian kepemilikan yang bukan

merupakan hilangnya pengendalian, diperhitungkan sebagai transaksi ekuitas. Oleh karena itu, perubahan tersebut tidak memiliki dampak terhadap goodwill dan tidak menimbulkan laba atau rugi yang diakui dalam laporan laba rugi;

ii. A change in the ownership interest of a subsidiary that does not result in a loss of control is accounted for as an equity transaction. Therefore, such a change has no impact on goodwill, nor does it give rise to a gain or loss recognized in profit and loss;

iii. Pada saat pengendalian terhadap entitas anak

hilang, semua kepentingan yang dimiliki diukur pada nilai wajar dengan laba rugi yang diakui di dalam laporan laba rugi;

iii. When control over a subsidiary is lost, any interest retained is measured at fair value with the corresponding gain or loss recognized in profit and loss.

iv. Pertimbangan keberadaan dan dampak hak suara

potensial yang dapat dilaksanakan dan dikonversi, termasuk hak suara potensial yang dimiliki oleh entitas lain,di dalam penilaian pengendalian;

iv. Considerations for the existence and effect of potential voting rights that are currently exercisable or convertible, including potential voting rights held by another entity, in assessment of control.

v. Ketika entitas induk mengakuisisi entitas anak

sebelum tanggal 1 Januari 2011 yang bertujuan untuk dijual dalam jangka pendek dan entitas anak dengan pembatasan jangka panjang signifikan yang mempengaruhi kemampuan untuk mengalihkan dana kepada entitas induk, entitas induk harus mengkonsolidasikan entitas-entitas tersebut sesuai dengan PSAK 4 (R2009) secara prospektif.

v. When the parent entity have acquired subsidiaries before 1 January 2011 for the purpose of short-term disposal and subsidiaries with significant long-term restriction that affects the ability to transfer funds to the parent entity, the parent entity shall consolidate these entities in accordance with the PSAK 4 (Revised 2009) prospectively.

Adopsi PSAK 4 (Revisi 2009) tidak memiliki dampak material kepada laporan keuangan konsolidasian Grup dalam hal transaksi dengan kepentingan nonpengendali, yang diatribusikan kepada kerugian kepentingan nonpengendali dan pelepasan entitas anak sebelum tanggal 1 Januari 2011.

The adoption of the PSAK 4 (Revised 2009) has no material impact to the Groups consolidated financial statements in respect of transactions with non-controlling interests, attribution of losses to non-controlling interests and disposal of subsidiaries prior to 1 January 2011.

Informasi komparatif telah disajikan kembali dalam hal kepentingan nonpengendali yang disajikan sebagai bagian ekuitas. Dengan demikian kepatuhan terhadap standar revisian telah dicapai.

Comparative information has been re-presented with respect to non-controlling interest presented as part of equity, so that compliance with the revised standard is achieved.

PSAK 5 (Revisi 2009), Segmen Operasi PSAK 5 (Revised 2009), Operating Segment

Standar revisi ini menentukan dan menyajikan segmen operasi berdasarkan informasi yang digunakan oleh pengambil keputusan operasional Grup.

This revised standard determines and presents operating segments based on the information used by operational decision-making group.

Sebelumnya informasi segmen disajikan berdasarkan segmen usaha dan segmen geografis. Namun demikian, pengambil keputusan operasional Grup, tetap menggunakan basis yang sama yaitu berdasarkan sifat produk dan jasa. Pengaruh dari penerapan standar revisi ini terhadap penyusunan laporan keuangan konsolidasian tidak signifikan.

Previous segment information is presented based on business segments and geographical segments. However, the operational decision-making group, still using the same basis that is based on the nature of products and services. Effect of application of this revised standard on the consolidated financial statements was not significant.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/9 Exhibit E/9

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

(Continued)

a. Dasar Pengukuran dan Penyusunan Laporan Keuangan Konsolidasian (Lanjutan)

a. Basis of Preparation of the Consolidated Financial Statements (Continued)

PSAK 22 (Revisi 2010), Kombinasi Bisnis (Lanjutan)

PSAK 22 (Revised 2010), Business Combinations(Continued)

iv. Grup memilih untuk setiap akuisisi bisnis, untuk

mengukur kepentingan nonpengendali (KNP) pada nilai wajar, atau pada bagian proporsional kepentingan nonpengendali pada aset bersih yang terindentifikasi entitas yang diakuisisi;

iv. The group elects for each acquisition of a business, to measure non-controlling interest (NCI) at fair value, or at the non-controlling interests proportionate share of the acquirees identifiable net assets;

v. Pada saat suatu bisnis diakuisisi secara bertahap,

kepemilikan sebelumnya pada entitas yang diakusisi, diukur pada nilai wajar pada tanggal akuisisi dengan laba atau rugi yang diakui di dalam laporan laba-rugi;

v. When a business is acquired in stages, the previously held equity interest in the acquiree is remeasured to fair value at the acquisition date with any corresponding gain or loss recognized in profit and loss;

vi. Goodwill tidak lagi diamortisasi dan akumulasi

amortisasi goodwill dihapuskan dengan mengurangi pada nilai goodwill. Penurunan nilai goodwill diuji berdasarkan PSAK 48 (R2009), Penurunan Nilai Aset;

vi. Goodwill is no longer amortized and the accumulated amortization is written off against its cost. It will be subjected to annual impairment testing in accordance with PSAK 48 (Revised 2009), Impairment of Assets;

Standar akuntansi dan interpretasi baru/revisi, serta pencabutan standar berikut, yang relevan terhadap kegiatan operasi Grup, telah dipublikasikan dan akan efektif pada tahun 2012 adalah:

The following new/revised accounting standards, interpretations and withdrawal of standards, which are relevant to the Groups operations, were published and to be effective in 2012, as follows:

PSAK 10 (R2010) Pengaruh Perubahan Nilai Tukar valuta Asing/ Effects of Changes in Foreign Exchange Rates PSAK 18 (R2010) Akuntansi dan Pelaporan Program Manfaat Purna Karya/ Accounting and Reporting by Retirement

Benefit Plans PSAK 24 (R2010) Imbalan Kerja/ Employee Benefits PSAK 36 (R2010) Akuntansi Asuransi Jiwa/ Insurance Contracts PSAK 46 (R2010) Pajak Penghasilan/ Income Taxes PSAK 50 (R2010) Instrumen Keuangan: Penyajian/ Financial Instruments: Presentation PSAK 56 (R2010) Laba Per Saham/ Earnings per share PSAK 60 Instrumen Keuangan: Pengungkapan/ Financial Instruments: Disclosure PSAK 62 Kontrak Asuransi/ Insurance Contracts ISAK 15 PSAK 24 Batas Aset Imbalan Pasti, Persyaratan Pendanaan Minimum dan Interaksinya/ PSAK 24

The Limit on a Defined Benefit Asset, Minimum Funding Requirements and Their Interaction ISAK 16 Perjanjian Konsesi Jasa/ Service Concession Arrangements ISAK 20 Pajak Penghasilan Perubahan Dalam Status Pajak Entitas atau Para Pemegang Sahamnya/ Income

Taxes Changes in the Tax Status of an Entity or its Shareholders ISAK 22 Perjanjian Konsesi Jasa Pengungkapan/ Service Concession Arrangements Disclosure ISAK 23 Sewa Operasi Insentif/ Operating Lease Incentives ISAK 24 Evaluasi Substansi Beberapa Transaksi yang Meliputi Suatu Bentuk Legal Sewa/ Evaluating the

Substance of Transactions Involving the Legal Form of a Lease

b. Dasar Konsolidasi b. Basis of Consolidation

Kombinasi bisnis Business combination

Kombinasi bisnis dihitung dengan menggunakan metode akuisisi pada tanggal akuisisi, yaitu tanggal pengendalian beralih kepada Grup. Pengendalian adalah kekuasaan untuk mengatur kebijakan keuangan dan kebijakan operasi entitas untuk memperoleh manfaat dari aktivitasnya. Di dalam menilai pengendalian, Grup mempertimbangkan hak suara potensial yang saat ini dilaksanakan.

Business combinations are accounted for using the acquisition method as at the acquisition date, which is the date on which control is transferred to the Group. Control is the power to govern the financial and operating policies of an entity so as to obtain benefits from its activities. In assessing control, the Group takes into consideration potential voting rights that are currently exercisable.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/8 Exhibit E/8

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

(Continued)

a. Dasar Pengukuran dan Penyusunan Laporan Keuangan Konsolidasian (Lanjutan)

a. Basis of Preparation of the Consolidated Financial Statements (Continued)

PSAK 7, Pengungkapan Pihak-Pihak Berelasi PSAK 7, Related Party Disclosures

PSAK 7 menyempurnakan definisi dan pengungkapan untuk pihak-pihak berelasi. Standar ini berdampak pada identifikasi pihak terkait dan tambahan pengungkapan pihak-pihak berelasi.

PSAK 7 enhances the definitions and disclosures for related parties. The standard affected the identification of related parties and additional related party disclosures.

Pengungkapan pihak-pihak berelasi yang diungkapkan pada Catatan 36 telah disusun sesuai dengan standar ini dan perubahan tersebut diterapkan secara retrospektif.

The related party disclosures as disclosed in Note 36have been prepared in accordance with the standard and the changes has been applied retrospectively.

PSAK 22 (Revisi 2010), Kombinasi Bisnis PSAK 22 (Revised 2010), Business Combinations

PSAK 22 (Revisi 2010) mengemukakan perubahan akuntansi bagi akuntansi kombinasi bisnis yang memperngaruhi jumlah goodwill yang diakui, hasil yang dilaporkan pada periode di mana akuisisi terjadi, dan hasil-hasil yang dilaporan di masa depan. Perubahan di dalam kebijakan akuntansi signifikan yang merupakan hasil adopsi PSAK 22 (Revisi 2010) meliputi:

The PSAK 22 (Revised 2010) introduces changes to the accounting for business combinations which affect the amount of goodwill recognized, the reported results in the period that an acquisition occurs, and future reported results. Changes in significant accounting policies resulting from the adoption of PSAK 22 (Revised 2010) include:

i. Biaya transaksi yang tidak lagi dikapitalisasi

sebagai bagian biaya akuisisi, namun langsung dibebankan;

i. Transaction costs are no longer capitalized as part of the cost of acquisition but are expensed immediately;

ii. Biaya terkait akuisisi adalah biaya yang

dikeluarkan pihak pengakuisisi dalam rangka kombinasi bisnis. Biaya tersebut mencakup biaya makelar (finders fee); advis, hukum, akuntansi, penilaian dan biaya professional atau konsultasi lainnya; biaya administrasi umum, termasuk biaya pemeliharaan departemen akuisisi internal; dan biaya pendaftaran serta penerbitan efek utang dan efek ekuitas. Pihak pengakuisisi mencatat biaya terkait akuisisi sebagai beban pada periode saat biaya tersebut terjadi dan jasa diterima dengan satu pengecualian. Biaya untuk menerbitkan efek utang dan efek ekuitas diakui sesuai PSAK 55 (Revisi 2006): Instrumen Keuangan: Pengakuan dan Pengukuran dan PSAK 50 (Revisi 2006): Instrumen Keuangan: Penyajian dan Pengungkapan.

ii. Costs related to acquisition are costs incurred by the acquirer in business combinations. The costs are included finder's fee; advice, legal, accounting, valuation and professional fees or other consulting fees; general administrative costs, including maintenance of internal acquisitions department, and the cost of registration and issuance of debt securities and equity securities. The acquirer's recorded acquisition-related costs as an expense in the period when that cost is incurred and the services received with one exception. Costs for issuing debt securities and equity securities are recognized in accordance with PSAK 55 (Revised 2006): Financial Instruments: Recognition and Measurement and PSAK 50 (Revised 2006): Financial Instruments: Presentation and Disclosure.

iii. Pertimbangan akan kontinjensi terhadap kejadian

di masa yang akan datang yang diakui sebesar nilai wajar pada tanggal akuisisi, dan segala perubahan nilai yang dipertimbangkan akan dibayarkan, tidak lagi disesuaikan dengan mengurangi nilai goodwill, namun diakui di dalam laporan laba rugi;

iii. Consideration contingent on future events is recognized at fair value on the acquisition date, and any changes in the amount of consideration to be paid are no longer adjusted against goodwill but are recognized in profit and loss;

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/9 Exhibit E/9

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

(Continued)

a. Dasar Pengukuran dan Penyusunan Laporan Keuangan Konsolidasian (Lanjutan)

a. Basis of Preparation of the Consolidated Financial Statements (Continued)

PSAK 22 (Revisi 2010), Kombinasi Bisnis (Lanjutan)

PSAK 22 (Revised 2010), Business Combinations(Continued)

iv. Grup memilih untuk setiap akuisisi bisnis, untuk

mengukur kepentingan nonpengendali (KNP) pada nilai wajar, atau pada bagian proporsional kepentingan nonpengendali pada aset bersih yang terindentifikasi entitas yang diakuisisi;

iv. The group elects for each acquisition of a business, to measure non-controlling interest (NCI) at fair value, or at the non-controlling interests proportionate share of the acquirees identifiable net assets;

v. Pada saat suatu bisnis diakuisisi secara bertahap,

kepemilikan sebelumnya pada entitas yang diakusisi, diukur pada nilai wajar pada tanggal akuisisi dengan laba atau rugi yang diakui di dalam laporan laba-rugi;

v. When a business is acquired in stages, the previously held equity interest in the acquiree is remeasured to fair value at the acquisition date with any corresponding gain or loss recognized in profit and loss;

vi. Goodwill tidak lagi diamortisasi dan akumulasi

amortisasi goodwill dihapuskan dengan mengurangi pada nilai goodwill. Penurunan nilai goodwill diuji berdasarkan PSAK 48 (R2009), Penurunan Nilai Aset;

vi. Goodwill is no longer amortized and the accumulated amortization is written off against its cost. It will be subjected to annual impairment testing in accordance with PSAK 48 (Revised 2009), Impairment of Assets;

Standar akuntansi dan interpretasi baru/revisi, serta pencabutan standar berikut, yang relevan terhadap kegiatan operasi Grup, telah dipublikasikan dan akan efektif pada tahun 2012 adalah:

The following new/revised accounting standards, interpretations and withdrawal of standards, which are relevant to the Groups operations, were published and to be effective in 2012, as follows:

PSAK 10 (R2010) Pengaruh Perubahan Nilai Tukar valuta Asing/ Effects of Changes in Foreign Exchange Rates PSAK 18 (R2010) Akuntansi dan Pelaporan Program Manfaat Purna Karya/ Accounting and Reporting by Retirement

Benefit Plans PSAK 24 (R2010) Imbalan Kerja/ Employee Benefits PSAK 36 (R2010) Akuntansi Asuransi Jiwa/ Insurance Contracts PSAK 46 (R2010) Pajak Penghasilan/ Income Taxes PSAK 50 (R2010) Instrumen Keuangan: Penyajian/ Financial Instruments: Presentation PSAK 56 (R2010) Laba Per Saham/ Earnings per share PSAK 60 Instrumen Keuangan: Pengungkapan/ Financial Instruments: Disclosure PSAK 62 Kontrak Asuransi/ Insurance Contracts ISAK 15 PSAK 24 Batas Aset Imbalan Pasti, Persyaratan Pendanaan Minimum dan Interaksinya/ PSAK 24

The Limit on a Defined Benefit Asset, Minimum Funding Requirements and Their Interaction ISAK 16 Perjanjian Konsesi Jasa/ Service Concession Arrangements ISAK 20 Pajak Penghasilan Perubahan Dalam Status Pajak Entitas atau Para Pemegang Sahamnya/ Income

Taxes Changes in the Tax Status of an Entity or its Shareholders ISAK 22 Perjanjian Konsesi Jasa Pengungkapan/ Service Concession Arrangements Disclosure ISAK 23 Sewa Operasi Insentif/ Operating Lease Incentives ISAK 24 Evaluasi Substansi Beberapa Transaksi yang Meliputi Suatu Bentuk Legal Sewa/ Evaluating the

Substance of Transactions Involving the Legal Form of a Lease

b. Dasar Konsolidasi b. Basis of Consolidation

Kombinasi bisnis Business combination

Kombinasi bisnis dihitung dengan menggunakan metode akuisisi pada tanggal akuisisi, yaitu tanggal pengendalian beralih kepada Grup. Pengendalian adalah kekuasaan untuk mengatur kebijakan keuangan dan kebijakan operasi entitas untuk memperoleh manfaat dari aktivitasnya. Di dalam menilai pengendalian, Grup mempertimbangkan hak suara potensial yang saat ini dilaksanakan.

Business combinations are accounted for using the acquisition method as at the acquisition date, which is the date on which control is transferred to the Group. Control is the power to govern the financial and operating policies of an entity so as to obtain benefits from its activities. In assessing control, the Group takes into consideration potential voting rights that are currently exercisable.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/11 Exhibit E/11

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan)

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Lanjutan)

b. Dasar Konsolidasi (Lanjutan) b. Basis of Consolidation (Continued)

Investasi pada entitas asosiasi Investments in associates

Entitas asosiasi adalah entitas di mana Grup memiliki pengaruh signifikan, namun bukan mengendalikan, terhadap kebijakan keuangan dan kebijakan operasi entitas tersebut. Pengaruh signifikan diasumsikan terjadi ketika Grup memiliki antara 20% sampai 50% hak suara entitas lain.

Associates are those entities in which the Group has significant influence, but not control, over the financial and operating policies of these entities. Significant influence is presumed to exist when the Group holds between 20% and 50% of the voting power of another entity.

Investee dicatat dengan menggunakan metode ekuitas (equity-accounted investees) dan diakui sebesar harga perolehan pada saat awal perolehan. Biaya investasi termasuk biaya transaksi.

Investments in associates are accounted for using the equity method (equity-accounted investees) and are recognized initially at cost. The cost of the investments includes transaction costs.

Laporan keuangan konsolidasian mencakup bagian laba rugi Grup dan pendapatan komprehensif lain dari investee yang dicatat dengan menggunakan metode ekuitas, setelah penyesuaian untuk menyelaraskan kebijakan akuntansi investee yang dicatat dengan menggunakan metode ekuitas dihitung dengan kebijakan Grup, sejak tanggal terjadinya pengaruh signifikan sampai dengan pengaruh signifikan berakhir.

The consolidated financial statements include the Groups share of the profit or loss and other comprehensive income of the equity-accounted investees, after adjustments to align the accounting policies of the equity-accounted investees with those of the Group, from the date that significant influence commences until the date that significant influence ceases.

Mulai tahun 2010, penyertaan saham pada perusahaan non publik dibawah 20% diklasifikasikan sebagai asset keuangan tersedia untuk dijual. Lihat Catatan 2f untuk kebijakan akuntansi atas aset keuangan tersedia untuk dijual.

Starting 2010, investments in shares of non publicly held company with ownership below 20% are classified as financial assets available-for sale. See Note 2f for the accounting policy of financial assets available-for sale.

Apabila bagian kerugian Grup melebihi kepentingan di dalam investee yang dihitung dengan menggunakan metode ekuitas, jumlah tercatat dari bagian tersebut, termasuk investasi jangka panjang, dikurangi sampai nol, dan pengakuan dari kerugian selanjutnya dihentikan kecuali Grup memiliki liabilitas atau melakukan pembayaran atas nama investee.

When the Groups share of losses exceeds its interest in an equity-accounted investee, the carrying amount of that interest, including any long-term investments, is reduced to zero, and the recognition of further losses is discontinued except to the extent that the Group has an obligation or has made payments on behalf of the investee.

Transaksi kepentingan nonpengendali Transactions with non-controlling interests

Akuisisi kepentingan nonpengendali dihitung sebagai transaksi dengan pemilik dalam kapasitasnya sebagai pemilik dan oleh karena itu tidak terdapat goodwill yang diakui sebagai hasil transaksi tersebut. Penyesuaian kepentingan nonpengendali berdasarkan jumlah proporsional aset bersih entitas anak.

Acquisitions of non-controlling interests are accounted for as transactions with owners in their capacity as owners and therefore no goodwill is recognized as a result of such transactions. The adjustments to non-controlling interests are based on a proportionate amount of the net assets of the subsidiary.

Saldo dan transaksi antar Grup dan semua pendapatan dan beban yang belum terealisasi yang timbul dari transaksi antar Grup, dieliminasi di dalam penyusunan dan penyajian laporan keuangan konsolidasian. Laba yang belum terealisasi yang timbul dari transaksi dengan entitas asosiasi dieliminasi terhadap investasi dari bagian Grup di dalam investee. Kerugian yang belum terealisasi dieliminasi dengan cara yang sama dengan keuntungan yang belum terealisasi, hanya apabila tidak terdapat bukti penurunan nilai.

Intra-group balances and transactions, and any unrealized income and expenses arising from intra-group transactions, are eliminated in preparing the consolidated financial statements. Unrealized gains arising from transactions with associates are eliminated against the investment to the extent of the Groups interest in the investee. Unrealized losses are eliminated in the same way as unrealized gains, but only to the extent that there is no evidence of impairment.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/10 Exhibit E/10

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan)

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Lanjutan)

b. Dasar Konsolidasi (Lanjutan) b. Basis of Consolidation (Continued)

Imbalan yang dialihkan tidak termasuk jumlah yang terkait dengan penyelesaian pada hubungan yang sebelumnya ada. Jumlah tersebut, umumnya diakui di dalam laporan laba rugi.

The consideration transferred does not include amounts related to the settlement of preexisting relationships. Such amounts are generally recognized in profit or loss.

Biaya-biaya terkait dengan akuisisi, selain yang terkait dengan penerbitan surat utang maupun kepemilikan, yang terjadi dalam kaitan kombinasi bisnis Grup, dibebankan pada saat terjadinya.

Costs related to the acquisition, other than those associated with the issue of debt or equity securities, that the Group incurs in connection with a business combination are expensed as incurred.

Semua imbalan kontinjensi diakui pada nilai wajar pada saat tanggal akuisisi. Apabila imbalan kontinjensi diklasifikasikan sebagai ekuitas, maka hal tersebut tidak diukur kembali dan penyelesaiannya dicatat di dalam ekuitas. Selain itu, perubahan berikutnya terhadap nilai wajar imbalan kontinjensi diakui di dalam laporan laba rugi.

Any contingent consideration payable is recognized at fair value at the acquisition date. If the contingent consideration is classified as equity, it is not remeasured and settlement is accounted for within equity. Otherwise, subsequent changes to the fair value of the contingent consideration are recognized in profit or loss.

Entitas anak Subsidiaries

Entitas Anak adalah entitas yang dikendalikan oleh Grup. Laporan keuangan entitas anak termasuk ke dalam laporan keuangan konsolidasian sejak tanggal pengendalian dimulai sampai dengan tanggal pengendalian dihentikan. Kebijakan akuntansi entitas anak diubah apabila dipandang perlu untuk menyelaraskan kebijakan akuntansi yang diadopsi oleh Grup.

Subsidiaries are entities controlled by the Group. The financial statements of subsidiaries are included in the consolidated financial statements from the date that control commences until the date that control ceases. The accounting policies of subsidiaries have been changed when necessary to align them with the policies adopted by the Group.

Kerugian yang terjadi pada kepentingan nonpengendali pada entitas anak dialokasikan kepada kepentingan nonpengendali bahkan apabila dialokasikan kepada kepentingan nonpengendali tersebut dapat menimbulkan saldo defisit. Kepentingan nonpengendali disajikan di dalam laporan keuangan konsolidasian pada bagian ekuitas, yang terpisah dari ekuitas pemilik entitas induk.

Losses applicable to the non-controlling interests in a subsidiary are allocated to the non-controlling interests even if doing so causes the non-controlling interests to have a deficit balance. Non-controlling interests is presented in the consolidated statement of financial position within equity, separately from the equity of the owners of the parent.

Setelah terjadi hilangnya pengendalian, Grup menghentikan pengakuan aset dan liabilitas entitas anak, semua kepentingan nonpengendali dan komponen ekuitas lainnya terkait dengan entitas anak. Segala surplus atau defisit yang timbul dari hilangnya pengendalian, diakui di dalam laporan laba rugi. Apabila Grup menahan semua bagian di dalam entitas anak sebelumnya, maka bagian tersebut diukur pada nilai wajar pada tanggal saat pengendalian dihentikan. Selanjutnya, bagian tersebut dicatat sebagai investee dengan ekuitas yang dihitung atau sebagai aset keuangan tersedia untuk dijual bergantung pada besarnya pengaruh.

Upon the loss of control, the Group derecognizes the assets and liabilities of the subsidiary, any non-controlling interests and the other components of equity related to the subsidiary. Any surplus or deficit arising on the loss of control is recognized in profit or loss. If the Group retains any interest in the previous subsidiary, then such interest is measured at fair value at the date that control is lost. Subsequently, it is accounted for as an equity-accounted investee or as an available-for-sale financial asset depending on the level of influence retained.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/11 Exhibit E/11

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan)

2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (Lanjutan)

b. Dasar Konsolidasi (Lanjutan) b. Basis of Consolidation (Continued)

Investasi pada entitas asosiasi Investments in associates

Entitas asosiasi adalah entitas di mana Grup memiliki pengaruh signifikan, namun bukan mengendalikan, terhadap kebijakan keuangan dan kebijakan operasi entitas tersebut. Pengaruh signifikan diasumsikan terjadi ketika Grup memiliki antara 20% sampai 50% hak suara entitas lain.

Associates are those entities in which the Group has significant influence, but not control, over the financial and operating policies of these entities. Significant influence is presumed to exist when the Group holds between 20% and 50% of the voting power of another entity.

Investee dicatat dengan menggunakan metode ekuitas (equity-accounted investees) dan diakui sebesar harga perolehan pada saat awal perolehan. Biaya investasi termasuk biaya transaksi.

Investments in associates are accounted for using the equity method (equity-accounted investees) and are recognized initially at cost. The cost of the investments includes transaction costs.

Laporan keuangan konsolidasian mencakup bagian laba rugi Grup dan pendapatan komprehensif lain dari investee yang dicatat dengan menggunakan metode ekuitas, setelah penyesuaian untuk menyelaraskan kebijakan akuntansi investee yang dicatat dengan menggunakan metode ekuitas dihitung dengan kebijakan Grup, sejak tanggal terjadinya pengaruh signifikan sampai dengan pengaruh signifikan berakhir.

The consolidated financial statements include the Groups share of the profit or loss and other comprehensive income of the equity-accounted investees, after adjustments to align the accounting policies of the equity-accounted investees with those of the Group, from the date that significant influence commences until the date that significant influence ceases.

Mulai tahun 2010, penyertaan saham pada perusahaan non publik dibawah 20% diklasifikasikan sebagai asset keuangan tersedia untuk dijual. Lihat Catatan 2f untuk kebijakan akuntansi atas aset keuangan tersedia untuk dijual.

Starting 2010, investments in shares of non publicly held company with ownership below 20% are classified as financial assets available-for sale. See Note 2f for the accounting policy of financial assets available-for sale.

Apabila bagian kerugian Grup melebihi kepentingan di dalam investee yang dihitung dengan menggunakan metode ekuitas, jumlah tercatat dari bagian tersebut, termasuk investasi jangka panjang, dikurangi sampai nol, dan pengakuan dari kerugian selanjutnya dihentikan kecuali Grup memiliki liabilitas atau melakukan pembayaran atas nama investee.

When the Groups share of losses exceeds its interest in an equity-accounted investee, the carrying amount of that interest, including any long-term investments, is reduced to zero, and the recognition of further losses is discontinued except to the extent that the Group has an obligation or has made payments on behalf of the investee.

Transaksi kepentingan nonpengendali Transactions with non-controlling interests

Akuisisi kepentingan nonpengendali dihitung sebagai transaksi dengan pemilik dalam kapasitasnya sebagai pemilik dan oleh karena itu tidak terdapat goodwill yang diakui sebagai hasil transaksi tersebut. Penyesuaian kepentingan nonpengendali berdasarkan jumlah proporsional aset bersih entitas anak.

Acquisitions of non-controlling interests are accounted for as transactions with owners in their capacity as owners and therefore no goodwill is recognized as a result of such transactions. The adjustments to non-controlling interests are based on a proportionate amount of the net assets of the subsidiary.

Saldo dan transaksi antar Grup dan semua pendapatan dan beban yang belum terealisasi yang timbul dari transaksi antar Grup, dieliminasi di dalam penyusunan dan penyajian laporan keuangan konsolidasian. Laba yang belum terealisasi yang timbul dari transaksi dengan entitas asosiasi dieliminasi terhadap investasi dari bagian Grup di dalam investee. Kerugian yang belum terealisasi dieliminasi dengan cara yang sama dengan keuntungan yang belum terealisasi, hanya apabila tidak terdapat bukti penurunan nilai.

Intra-group balances and transactions, and any unrealized income and expenses arising from intra-group transactions, are eliminated in preparing the consolidated financial statements. Unrealized gains arising from transactions with associates are eliminated against the investment to the extent of the Groups interest in the investee. Unrealized losses are eliminated in the same way as unrealized gains, but only to the extent that there is no evidence of impairment.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/13 Exhibit E/13

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

(Continued)

c. Transaksi dan Saldo dalam Mata Uang Asing c. Foreign Currencies Transactions and Balance Transaksi-transaksi selama tahun berjalan dalam mata uang asing dicatat dengan kurs yang berlaku pada saat terjadinya transaksi. Pada tanggal neraca konsolidasian, aset dan liabilitas moneter dalam mata uang asing disesuaikan untuk mencerminkan kurs yang berlaku pada tanggal tersebut.

Transactions during the year involving foreign currencies are recorded at the rates of exchange prevailing at the time the transactions were made. As at the consolidated balance sheet dates, monetary assets and liabilities denominated in foreign currencies are adjusted to reflect the prevailing exchange rates as at those dates.

Pada tanggal 31 Desember 2011 dan 2010 kurs yang digunakan adalah:

The exchange rates as at 31 December 2011 and 2010are as follows:

2 0 1 1 2 0 1 0 1 USD 9.068,00 8.991,00 1 USD1 SGD 6.974,33 6.980,61 1 SGD1 EUR 11.738,99 11.955,79 1 EUR1 CHF 9.636,07 9.600,14 1 CHF Keuntungan atau kerugian kurs yang timbul dikreditkan atau dibebankan pada laba rugi tahun yang bersangkutan.

The resulting gains or losses on foreign exchanges are credited or charged to current year's profit and loss.

d. Kas dan Setara Kas d. Cash and Cash Equivalents

Kas dan setara kas meliputi uang kas, uang yang ada di bank serta deposito berjangka yang akan jatuh tempo dalam waktu tiga bulan atau kurang dari tanggal penempatannya dan tidak digunakan sebagai jaminan atas pinjaman serta tidak dibatasi penggunaannya.

Cash and cash equivalents include cash on hand and in banks and all time deposits which were within three months of maturity when acquired and not being used as collateral of loans and not restricted for use.

e. Penyisihan Piutang Ragu-ragu e. Provision for Doubtful Accounts

Sebelum 1 Januari 2010, penyisihan piutang ragu-ragu ditetapkan berdasarkan penelaahan yang mendalam terhadap kondisi masing-masing nasabah pada akhir periode. Saldo piutang dihapuskan melalui penyisihan piutang ragu-ragu yang bersangkutan atau langsung dihapuskan dari akun tersebut pada saat manajemen berkeyakinan penuh bahwa piutang tersebut tidak dapat ditagih.

Before 1 January 2010, provision for doubtful accounts is provided based on the review of the status of debtors at end of the period. The outstanding balance of receivables is written off against the respective provision for doubtful accounts or by direct write-off of the relevant account receivables when management is convinced that such accounts receivable were definitely uncollectible.

Mulai tahun 2010, nilai cadangan ditentukan berdasarkan kebijakan akuntansi yang dijabarkan di Catatan 2f.

Starting 2010, the allowance is determined based on accounting policy as described in Note 2f.

f. Instrumen Keuangan f. Financial Instruments

Instrumen keuangan terdiri dari aset keuangan dan liabilitas keuangan

Financial instruments consist of financial assets and financial liabilities

i. Aset Keuangan i. Financial Assets

Asset keuangannya diklasifikasikan dalam kategori (1) aset keuangan yang diukur pada nilai wajar melalui laporan laba rugi, (2) pinjaman yang diberikan dan piutang, (3) aset keuangan dimiliki hingga jatuh tempo, dan (4) aset keuangan tersedia untuk dijual. Klasifikasi ini tergantung dari tujuan perolehan aset keuangan tersebut.

Financial assets are classified into categories of (1) financial assets at fair value through profit or loss, (2) loans and receivables, (3) held-to-maturity financial assets, and (4) available-for-sale financial assets. The classification depends on the purpose for which the financials assets were acquired.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/12 Exhibit E/12

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

(Continued)

b. Dasar Konsolidasi (Lanjutan) b. Basis of Consolidation (Continued) Goodwill Goodwill Goodwill merupakan selisih biaya akuisisi entitas anak atau entitas asosiasi terhadap nilai wajar pada tanggal akuisisi bagian Grup terhadap aset bersih yang teridentifikasi, termasuk liabilitas kontinjensi, pada saat akuisisi. Biaya akuisisi diukur pada saat nilai wajar aset diperoleh, instrument ekuitas diterbitkan, atau liabilitas terjadi atau diasumsikan pada tanggal akuisisi, ditambah biaya-biaya yang dapat diatribusikan kepada akuisisi.

Goodwill represents the excess of the cost of an acquisition of subsidiaries or associated companies over the fair value at the date of acquisition of the Group's share of their identifiable net assets, including contingent liabilities, at the date of acquisition. The cost of acquisition is measured as the fair value of the assets acquired, equity instruments issued or liabilities incurred or assumed at the date of acquisition, plus costs directly attributable to the acquisition.

Goodwill negatif merupakan selisih nilai wajar pada tanggal akuisisi bagian Grup terhadap aset bersih yangteridentifikasi dengan biaya akuisisi. Goodwill negatif pada tanggal transaksi disesuaikan langsung pada laporan laba rugi.

Negative goodwill represents the excess of the fair value at the date of acquisition of the Group's share of their identifiable net assets over the cost of an acquisition. Negative goodwill at the date of transaction is adjusted directly to profit or loss.

Goodwill akuisisi entitas anak disajikan pada laporan posisi keuangan konsolidasian di mana goodwill akuisisi entitas asosiasi dicatat sebagai bagian nilai tercatat investasi terkait.

Goodwill on acquisition of subsidiaries is shown on the face of the consolidated statement of financial position whereas goodwill on acquisition of associated companies are recorded as part of the carrying value of the related investment.

Keuntungan atau kerugian pelepasan entitas anak dan entitas asosiasi meliputi nilai tercatat goodwill yang dikapitalisasi terkait dengan entitas yang dijual.

Gain or losses on disposal of subsidiaries and associates include the carrying amount of capitalized goodwill relating to the entity sold.

Goodwill diuji penurunan nilainya secara tahunan, atau secara berkala apabila terdapat indikasi goodwill mengalami penurunan.

Goodwill is tested for impairment annually, or more frequently if there is indication that the goodwill may be impaired.

Goodwill dialokasikan kepada tiap Unit Penghasil Kas (UPK) Grup yang diharapkan memberikan manfaat dari sinergi kombinasi bisnis, untuk tujuan pengujian penurunan nilai goodwill.

For the purpose of impairment testing of goodwill, goodwill is allocated to each of the Group's Cash-Generating-Units ("CGU") expected to benefit from synergies of the business combination.

Suatu kerugian penurunan nilai diakui di dalam laporan laba rugi ketika nilai tercatat UPK, termasuk goodwill, melebihi jumlah terpulihkan UPK. Jumlah terpulihkan UPK lebih tinggi dari nilai wajar UPK dikurangi biaya untuk menjual dan nilai pakainya. Di dalam menilai nilai pakai, arus kas masa depan yang diestimasi didiskontokan dengan nilai kininya dengan menggunakan tingkat suku bunga diskon sebelum pajak yang mencerminkan penilaian pasar kini terhadap nilai waktu uang dan risiko spesifik aset.

An impairment loss is recognized in the profit or loss when the carrying amount of CGU, including the goodwill, exceeds the recoverable amount of the CGU. The recoverable amount of the CGU is the higher of the CGU's fair value less cost to sell and value in use. In assessing value in use, the estimated future cash flows are discounted to their present value using a pre-tax discount rate that reflects current market assessment of the time value of money and the risks specific to the asset.

Total kerugian penurunan nilai dialokasikan, pertama untuk mengurangi nilai tercatat goodwill yang dialokasikan kepada UPK dan kemudian kepada aset UPK lainnya secara pro rata berdasarkan nilai tercatat tiap aset di dalam UPK.

The total impairment loss is allocated first to reduce the carrying amount of goodwill allocated to the CGU and then to other assets of the CGU pro-rated on the basis of the carrying amount of each asset in the CGU.

Penurunan kerugian goodwill tidak dapat dibaIikkan pada periode berikutnya.

Impairment loss on goodwill is not reversed in the subsequent period.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/13 Exhibit E/13

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

(Continued)

c. Transaksi dan Saldo dalam Mata Uang Asing c. Foreign Currencies Transactions and Balance Transaksi-transaksi selama tahun berjalan dalam mata uang asing dicatat dengan kurs yang berlaku pada saat terjadinya transaksi. Pada tanggal neraca konsolidasian, aset dan liabilitas moneter dalam mata uang asing disesuaikan untuk mencerminkan kurs yang berlaku pada tanggal tersebut.

Transactions during the year involving foreign currencies are recorded at the rates of exchange prevailing at the time the transactions were made. As at the consolidated balance sheet dates, monetary assets and liabilities denominated in foreign currencies are adjusted to reflect the prevailing exchange rates as at those dates.

Pada tanggal 31 Desember 2011 dan 2010 kurs yang digunakan adalah:

The exchange rates as at 31 December 2011 and 2010are as follows:

2 0 1 1 2 0 1 0 1 USD 9.068,00 8.991,00 1 USD1 SGD 6.974,33 6.980,61 1 SGD1 EUR 11.738,99 11.955,79 1 EUR1 CHF 9.636,07 9.600,14 1 CHF Keuntungan atau kerugian kurs yang timbul dikreditkan atau dibebankan pada laba rugi tahun yang bersangkutan.

The resulting gains or losses on foreign exchanges are credited or charged to current year's profit and loss.

d. Kas dan Setara Kas d. Cash and Cash Equivalents

Kas dan setara kas meliputi uang kas, uang yang ada di bank serta deposito berjangka yang akan jatuh tempo dalam waktu tiga bulan atau kurang dari tanggal penempatannya dan tidak digunakan sebagai jaminan atas pinjaman serta tidak dibatasi penggunaannya.

Cash and cash equivalents include cash on hand and in banks and all time deposits which were within three months of maturity when acquired and not being used as collateral of loans and not restricted for use.

e. Penyisihan Piutang Ragu-ragu e. Provision for Doubtful Accounts

Sebelum 1 Januari 2010, penyisihan piutang ragu-ragu ditetapkan berdasarkan penelaahan yang mendalam terhadap kondisi masing-masing nasabah pada akhir periode. Saldo piutang dihapuskan melalui penyisihan piutang ragu-ragu yang bersangkutan atau langsung dihapuskan dari akun tersebut pada saat manajemen berkeyakinan penuh bahwa piutang tersebut tidak dapat ditagih.

Before 1 January 2010, provision for doubtful accounts is provided based on the review of the status of debtors at end of the period. The outstanding balance of receivables is written off against the respective provision for doubtful accounts or by direct write-off of the relevant account receivables when management is convinced that such accounts receivable were definitely uncollectible.

Mulai tahun 2010, nilai cadangan ditentukan berdasarkan kebijakan akuntansi yang dijabarkan di Catatan 2f.

Starting 2010, the allowance is determined based on accounting policy as described in Note 2f.

f. Instrumen Keuangan f. Financial Instruments

Instrumen keuangan terdiri dari aset keuangan dan liabilitas keuangan

Financial instruments consist of financial assets and financial liabilities

i. Aset Keuangan i. Financial Assets

Asset keuangannya diklasifikasikan dalam kategori (1) aset keuangan yang diukur pada nilai wajar melalui laporan laba rugi, (2) pinjaman yang diberikan dan piutang, (3) aset keuangan dimiliki hingga jatuh tempo, dan (4) aset keuangan tersedia untuk dijual. Klasifikasi ini tergantung dari tujuan perolehan aset keuangan tersebut.

Financial assets are classified into categories of (1) financial assets at fair value through profit or loss, (2) loans and receivables, (3) held-to-maturity financial assets, and (4) available-for-sale financial assets. The classification depends on the purpose for which the financials assets were acquired.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/15 Exhibit E/15

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

(Continued)

f. Instrumen Keuangan (Lanjutan) f. Financial Instruments (Continued)

i. Aset Keuangan (Lanjutan) i. Financial Assets (Continued)

Pengukuran setelah pengakuan awal (Lanjutan) Subsequent measurement (Continued)

Pinjaman yang diberikan dan piutang Loans and receivables

Pinjaman yang diberikan dan piutang adalah aset keuangan non-derivatif dengan pembayaran tetap atau telah ditentukan, yang tidak mempunyai kuotasi di pasar aktif. Aset keuangan tersebut diukur sebesar biaya perolehan diamortisasi dengan menggunakan metode suku bunga efektif, dikurangi dengan penurunan nilai. Keuntungan dan kerugian diakui dalam laba rugi pada saat pinjaman yang diberikan dan piutang dihentikan pengakuannya atau mengalami penurunan nilai, serta melalui proses amortisasi.

Loans and receivables are non-derivative financial assets with fixed or determinable payments that are not quoted in an active market. Such financial assets are carried at amortized cost using the effective interest method, less any impairment. Gains and losses are recognized in profit and loss when the loans and receivables are derecognized or impaired, as well as through the amortization process.

Aset keuangan dimiliki hingga jatuh tempo

(HTM) Held-to-maturity financial assets (HTM)

Aset keuangan non-derivatif dengan pembayaran tetap atau telah ditentukan dan jatuh temponya telah ditetapkan diklasifikasikan sebagai HTM ketika Grup mempunyai intensi positif dan kemampuan untuk memiliki aset keuangan hingga jatuh tempo. Setelah pengukuran awal, aset keuangan HTM diukur pada biaya perolehan diamortisasi dengan menggunakan metode suku bunga efektif dikurangi penurunan nilai. Keuntungan atau kerugian diakui dalam laba rugi pada saat aset keuangan tersebut dihentikan pengakuannya atau mengalami penurunan nilai, serta melalui proses amortisasi.

Non-derivative financial assets with fixed or pre-determined payment and maturity has been established are classified as HTM when the Group havea positive intention and ability to hold the financial assets to maturity. After initial measurement, HTM financial assets are measured at amortized cost using the effective interest rate method less any impairment. Gains or losses are recognized in profit and loss when the financial assets are derecognized or impaired, as well as through the amortization process.

Aset keuangan tersedia untuk dijual (AFS) Available-for-sale financial assets (AFS)

Aset keuangan AFS adalah aset keuangan non derivatif yang ditetapkan sebagai tersedia untuk dijual atau yang tidak diklasifikasikan dalam tiga kategori sebelumnya. Setelah pengakuan awal, aset keuangan AFS diukur dengan nilai wajar dengan keuntungan atau kerugian yang belum terealisasi diakui dalam komponen ekuitas sampai aset keuangan tersebut dihentikan pengakuannya atau sampai diturunkan nilainya dan pada saat yang sama keuntungan atau kerugian kumulatif yang sebelumnya diakui dalam ekuitas harus diakui dalam laba rugi. Aset keuangan ini diklasifikasikan sebagai aset tidak lancar kecuali aset keuangan tersebut ditujukan untuk dilepaskan dalam waktu dua belas bulan dari tanggal neraca konsolidasian.

AFS financial assets are non-derivative financial assets that are designated as available-for-sale or are not classified in any of the three preceding categories. After initial recognition, AFS financial assets are measured at fair value with unrealized gains and losses being recognized as a component of equity until the financial assets are derecognized or until the financial assets are determined to be impaired at which time the cumulative gains or losses previously reported in equity are included in profit and loss. These financial assets are classified as non-current assets unless the intention is to dispose such assets within twelve months from the consolidated balance sheet date.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/14 Exhibit E/14

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

(Continued)

f. Instrumen Keuangan (Lanjutan) f. Financial Instruments (Continued)

i. Aset Keuangan (Lanjutan) i. Financial Assets (Continued)

Grup menentukan klasifikasi aset keuangan tersebut pada saat awal pengakuan-nya. Pengklasifikasian aset tersebut ditelaah kembali pada setiap akhir periode pelaporan keuangan, sepanjang diperbolehkan dan diperlukan dapat direklasifikasi.

Group determine the classification of their financial assets at initial recognition. The clasification of such assets are re-evaluated at the end of each reporting period and reclassified when appropriate and allowed.

Pengakuan awal Initial recognition

Aset keuangan pada awalnya diakui sebesar nilai wajarnya. Nilai wajar tersebut ditambah biaya transaksi yang dapat diatribusikan secara langsung dengan perolehan aset tersebut, kecuali untuk aset keuangan yang diklasifikasikan pada nilai wajar melalui laporan laba rugi, yang pada awalnya diukur dengan nilai wajar.

Financial assets are recognized initially at fair value. The fair value is added by transaction costs that are directly attributable to the acquisition of asset, except for those financial assets classified as at fair value through profit or loss which are initially measured at fair value.

Pengukuran setelah pengakuan awal Subsequent measurement

Pengukuran aset keuangan setelah pengakuan awal tergantung pada klasifikasinya sebagai berikut:

The subsequent measurement of financial assets depends on their classification as follows:

Aset keuangan yang diukur pada nilai wajar

melalui laporan laba rugi (FVTPL) Financial assets at fair value through profit or

loss (FVTPL)

Aset keuangan diklasifikasikan sebagai FVTPL jika aset keuangan diperoleh untuk diperdagangkan atau ditetapkan sebagai FVTPL pada saat pengakuan awal.

Financial assets are classified as at FVTPL where the financial assets are either held for trading or they are designated as FVTPL at initial recognition.

Aset keuangan diklasifikasikan sebagai kelompok diperdagangkan jika diperoleh untuk tujuan dijual atau dibeli kembali dalam waktu dekat. Aset derivatif juga diklasifikasikan sebagai kelompok diperdagangkan kecuali aset derivatif tersebut ditetapkan sebagai instrumen lindung nilai efektif.

Financial assets are classified as held for trading if they are acquired for the purpose of selling or repurchasing in the near term. Derivative assets are also classified as held for trading unless they are designated as effective hedging instruments.

Aset keuangan yang ditetapkan sebagai FVTPL disajikan dalam neraca konsolidasian pada nilai wajar dengan keuntungan atau kerugian dari perubahan nilai wajar diakui dalam laporan laba rugi konsolidasian. Keuntungan atau kerugian yang diakui dalam laba rugitermasuk dividen atau bunga yang diperoleh dari aset keuangan.

Financial assets at FVTPL are carried in the consolidated balance sheets at fair value with gains or losses recognized in the consolidated statements of income. The gains or losses recognized in profit and loss include any dividends or interest earned from the financial assets.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/15 Exhibit E/15

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

(Continued)

f. Instrumen Keuangan (Lanjutan) f. Financial Instruments (Continued)

i. Aset Keuangan (Lanjutan) i. Financial Assets (Continued)

Pengukuran setelah pengakuan awal (Lanjutan) Subsequent measurement (Continued)

Pinjaman yang diberikan dan piutang Loans and receivables

Pinjaman yang diberikan dan piutang adalah aset keuangan non-derivatif dengan pembayaran tetap atau telah ditentukan, yang tidak mempunyai kuotasi di pasar aktif. Aset keuangan tersebut diukur sebesar biaya perolehan diamortisasi dengan menggunakan metode suku bunga efektif, dikurangi dengan penurunan nilai. Keuntungan dan kerugian diakui dalam laba rugi pada saat pinjaman yang diberikan dan piutang dihentikan pengakuannya atau mengalami penurunan nilai, serta melalui proses amortisasi.

Loans and receivables are non-derivative financial assets with fixed or determinable payments that are not quoted in an active market. Such financial assets are carried at amortized cost using the effective interest method, less any impairment. Gains and losses are recognized in profit and loss when the loans and receivables are derecognized or impaired, as well as through the amortization process.

Aset keuangan dimiliki hingga jatuh tempo

(HTM) Held-to-maturity financial assets (HTM)

Aset keuangan non-derivatif dengan pembayaran tetap atau telah ditentukan dan jatuh temponya telah ditetapkan diklasifikasikan sebagai HTM ketika Grup mempunyai intensi positif dan kemampuan untuk memiliki aset keuangan hingga jatuh tempo. Setelah pengukuran awal, aset keuangan HTM diukur pada biaya perolehan diamortisasi dengan menggunakan metode suku bunga efektif dikurangi penurunan nilai. Keuntungan atau kerugian diakui dalam laba rugi pada saat aset keuangan tersebut dihentikan pengakuannya atau mengalami penurunan nilai, serta melalui proses amortisasi.

Non-derivative financial assets with fixed or pre-determined payment and maturity has been established are classified as HTM when the Group havea positive intention and ability to hold the financial assets to maturity. After initial measurement, HTM financial assets are measured at amortized cost using the effective interest rate method less any impairment. Gains or losses are recognized in profit and loss when the financial assets are derecognized or impaired, as well as through the amortization process.

Aset keuangan tersedia untuk dijual (AFS) Available-for-sale financial assets (AFS)

Aset keuangan AFS adalah aset keuangan non derivatif yang ditetapkan sebagai tersedia untuk dijual atau yang tidak diklasifikasikan dalam tiga kategori sebelumnya. Setelah pengakuan awal, aset keuangan AFS diukur dengan nilai wajar dengan keuntungan atau kerugian yang belum terealisasi diakui dalam komponen ekuitas sampai aset keuangan tersebut dihentikan pengakuannya atau sampai diturunkan nilainya dan pada saat yang sama keuntungan atau kerugian kumulatif yang sebelumnya diakui dalam ekuitas harus diakui dalam laba rugi. Aset keuangan ini diklasifikasikan sebagai aset tidak lancar kecuali aset keuangan tersebut ditujukan untuk dilepaskan dalam waktu dua belas bulan dari tanggal neraca konsolidasian.

AFS financial assets are non-derivative financial assets that are designated as available-for-sale or are not classified in any of the three preceding categories. After initial recognition, AFS financial assets are measured at fair value with unrealized gains and losses being recognized as a component of equity until the financial assets are derecognized or until the financial assets are determined to be impaired at which time the cumulative gains or losses previously reported in equity are included in profit and loss. These financial assets are classified as non-current assets unless the intention is to dispose such assets within twelve months from the consolidated balance sheet date.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/17 Exhibit E/17

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

(Continued)

f. Instrumen Keuangan (Lanjutan) f. Financial Instruments (Continued)

ii. Liabilitas Keuangan (Lanjutan) ii. Financial Liabilities (Continued)

Pengakuan awal dan pegukuran setelah pengakuan awal (Lanjutan)

Initial recognition and subsequent measurement(Continued)

Liabilitas keuangan yang tidak diklasifikasikan sebagai liabilitas keuangan yang diukur pada nilai wajar melalui laporan laba rugi diukur dengan biaya perolehan diamortisasi. Pada pengakuan awal liabilitas ini diakui pada nilai wajarnya ditambah biaya transaksi dan selanjutnya diukur pada biaya perolehan diamortisasi dengan menggunakan metode suku bunga efektif. Keuntungan dan kerugian diakui dalam laba rugi pada saat liabilitastersebut dihentikan pengakuannya serta melalui proses amortisasi.

Financial liabilities are not classified as financial liabilities at fair value through profit or loss are categorized and measured using amortized cost. On initial recognition of these liabilities, they are recognized at fair value added by the transaction costs and subsequenty are measure at amortized costs using the effective interest method. Gains and losses are recognized in profit and loss when the liabilities are derecognized as well as through the amortization process.

Perubahan nilai wajar terkait dengan liabilitaskeuangan yang ditetapkan untuk diukur pada nilai wajar melalui laporan laba rugi diakui di dalam Keuntungan/ (kerugian) dari perubahan nilai wajar instrumen keuangan dalam laporan laba rugi komprehensif konsolidasian. Beban bunga dari liabilitas keuangan diklasifikasikan sebagai diperdagangkan dicatat di dalam Beban bunga.

Fair value changes relating to financial liabilities designated at fair value through profit or loss are recognized in Gain/ (losses) from changes as fair value of financial instruments in the consolidated statements of comprehensive income. Interest expenses on financial liabilities held for trading are included in Interest expenses.

Penghentian pengakuan liabilitas keuangan Derecognition of financial liabilities

Grup menghentikan pengakuan liabilitas keuangan jika, dan hanya jika, liabilitas Grup dihentikan, dibatalkan atau kadaluwarsa.

Group derecognize financial liabilities when, and only when Group obligations are discharged, cancelled or expire.

iii. Saling Hapus Instrumen Keuangan iii. Offsetting of Financial Instruments

Aset keuangan dan liabilitas keuangan saling hapus dan nilai bersihnya dilaporkan dalam neraca konsolidasian jika, dan hanya jika, saat ini memiliki hak yang berkekuatan hukum untuk melakukan saling hapus atas jumlah yang telah diakui dan terdapat niat untuk menyelesaikannya secara neto, atau untuk merealisasikan aset dan menyelesaikan liabilitasnya secara simultan.

Financial assets and financial liabilities are offset and the net amount reported in the consolidated balance sheets if, and only if, there is a currently enforceable legal right to offset the recognized amounts and there is an intention to settle on a net basis, or to realize the assets and settle the liabilities simultaneously.

iv. Penurunan Nilai Aset Keuangan iv. Impairment of Financial Assets

Grup menilai pada tiap akhir periode pelaporan apakah terdapat bukti objektif suatu aset keuangan atau kelompok aset keuangan mengalami penurunan nilai.

The Group assesses at the end of each reporting period whether there is any objective evidence that a financial asset or group of financial assets is impaired.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/16 Exhibit E/16

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

(Continued)

f. Instrumen Keuangan (Lanjutan) f. Financial Instruments (Continued)

i. Aset Keuangan (Lanjutan) i. Financial Assets (Continued)

Penghentian pengakuan aset keuangan Derecognition of financial assets

Grup menghentikan pengakuan aset keuangan, jika dan hanya jika hak kontraktual atas arus kas yang berasal dari aset keuangan tersebut berakhir; atau Grup mentransfer hak kontraktual untuk menerima arus kas yang berasal dan dari aset keuangan; atau tetap memiliki hak kontraktual untuk menerima arus kas yang berasal dari aset keuangan namun juga menanggung liabilitas kontraktual untuk membayar arus kas yang diterima tersebut kepada satu atau lebih pihak penerima melalui suatu kesepakatan yang memenuhi persyaratan tertentu. Ketika Grup mentransfer aset keuangan, maka Grup mengevaluasi sejauh mana Grup tetap memiliki risiko dan manfaat atas kepemilikan aset keuangan tersebut.

The Group shall derecognize financial assets when, and only when the contractual rights to the cash flows from the financial assets expire; or the contractual rights to receive the cash flows of the financial assets are transferred to another entity or the contractual rights to receive the cash flows of the financial assets are retained but they assume a contractual obligation to pay the cash flows to one or more recipients in an arrangement that meets certain conditions. When Grouptransfer a financial asset, they shall evaluate the extent to which they retain the risks and rewards of ownership of the financial assets.

ii. Liabilitas Keuangan ii. Financial Liabilities

Liabilitas keuangan dikelompokkan ke dalam kategori (1) liabilitas keuangan yang diukur pada nilai wajar melalui laporan laba rugi dan (2) liabilitas keuangan yang diukur dengan biaya perolehan diamortisasi.

Financial liabilities are classified into (1) financial liabilities at fair value through profit or loss and (2) financial liabilities at amortized cost.

Liabilitas keuangan yang diukur pada nilai wajar melalui laporan laba rugi adalah liabilitas keuangan yang ditujukan untuk diperdagangkan. Liabilitaskeuangan diklasifikasikan sebagai diperdagangkan jika diperoleh terutama untuk tujuan dijual atau dibeli kembali dalam waktu dekat dan terdapat bukti mengenai pola ambil untung dalam jangka pendek terkini. Derivatif diklasifikasikan sebagai liabilitas diperdagangkan kecuali ditetapkan dan efektif sebagai instrumen lindung nilai.

Financial liabilities measured at fair value through profit or loss are the financial liabilities that are designated for trading. Financial liabilities are classified for trading if they are acquired primarily for the purpose of selling or repurchasing in the near term and there is evidence of a pattern of short-term profit taking. Derivatives are classified as trading liabilities except those effectively designated as hedging instruments.

Grup menetapkan klasifikasi liabilitas keuangannya pada saat pengakuan awal. Instrumen utang dan ekuitas dikelompokkan sebagai liabilitas keuangan atau sebagai ekuitas sesuai dengan substansi pengaturan kontraktual.

The Group determine the classification of their financial liabilities at initial recognition. Debt and equity instruments are classified as either financial liabilities or as equity in accordance with the substance of the contractual arrangement.

Pengakuan awal dan pegukuran setelah pengakuan awal

Initial recognition and subsequent measurement

Liabilitas keuangan pada awalnya diakui sebesar nilai wajarnya.

Financial liabilities are recognized initially at fair value.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/17 Exhibit E/17

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

(Continued)

f. Instrumen Keuangan (Lanjutan) f. Financial Instruments (Continued)

ii. Liabilitas Keuangan (Lanjutan) ii. Financial Liabilities (Continued)

Pengakuan awal dan pegukuran setelah pengakuan awal (Lanjutan)

Initial recognition and subsequent measurement(Continued)

Liabilitas keuangan yang tidak diklasifikasikan sebagai liabilitas keuangan yang diukur pada nilai wajar melalui laporan laba rugi diukur dengan biaya perolehan diamortisasi. Pada pengakuan awal liabilitas ini diakui pada nilai wajarnya ditambah biaya transaksi dan selanjutnya diukur pada biaya perolehan diamortisasi dengan menggunakan metode suku bunga efektif. Keuntungan dan kerugian diakui dalam laba rugi pada saat liabilitastersebut dihentikan pengakuannya serta melalui proses amortisasi.

Financial liabilities are not classified as financial liabilities at fair value through profit or loss are categorized and measured using amortized cost. On initial recognition of these liabilities, they are recognized at fair value added by the transaction costs and subsequenty are measure at amortized costs using the effective interest method. Gains and losses are recognized in profit and loss when the liabilities are derecognized as well as through the amortization process.

Perubahan nilai wajar terkait dengan liabilitaskeuangan yang ditetapkan untuk diukur pada nilai wajar melalui laporan laba rugi diakui di dalam Keuntungan/ (kerugian) dari perubahan nilai wajar instrumen keuangan dalam laporan laba rugi komprehensif konsolidasian. Beban bunga dari liabilitas keuangan diklasifikasikan sebagai diperdagangkan dicatat di dalam Beban bunga.

Fair value changes relating to financial liabilities designated at fair value through profit or loss are recognized in Gain/ (losses) from changes as fair value of financial instruments in the consolidated statements of comprehensive income. Interest expenses on financial liabilities held for trading are included in Interest expenses.

Penghentian pengakuan liabilitas keuangan Derecognition of financial liabilities

Grup menghentikan pengakuan liabilitas keuangan jika, dan hanya jika, liabilitas Grup dihentikan, dibatalkan atau kadaluwarsa.

Group derecognize financial liabilities when, and only when Group obligations are discharged, cancelled or expire.

iii. Saling Hapus Instrumen Keuangan iii. Offsetting of Financial Instruments

Aset keuangan dan liabilitas keuangan saling hapus dan nilai bersihnya dilaporkan dalam neraca konsolidasian jika, dan hanya jika, saat ini memiliki hak yang berkekuatan hukum untuk melakukan saling hapus atas jumlah yang telah diakui dan terdapat niat untuk menyelesaikannya secara neto, atau untuk merealisasikan aset dan menyelesaikan liabilitasnya secara simultan.

Financial assets and financial liabilities are offset and the net amount reported in the consolidated balance sheets if, and only if, there is a currently enforceable legal right to offset the recognized amounts and there is an intention to settle on a net basis, or to realize the assets and settle the liabilities simultaneously.

iv. Penurunan Nilai Aset Keuangan iv. Impairment of Financial Assets

Grup menilai pada tiap akhir periode pelaporan apakah terdapat bukti objektif suatu aset keuangan atau kelompok aset keuangan mengalami penurunan nilai.

The Group assesses at the end of each reporting period whether there is any objective evidence that a financial asset or group of financial assets is impaired.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/19 Exhibit E/19

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

(Continued)

f. Instrumen Keuangan (Lanjutan) f. Financial Instruments (Continued)

iv. Penurunan Nilai Aset Keuangan (Lanjutan) iv. Impairment of Financial Assets (Continued)

a) Aset yang dinilai dengan biaya perolehan diamortisasi (Lanjutan)

a) Assets carried at amortized cost (Continued)

Apabila di dalam periode berikutnya, jumlah kerugian penurunan nilai menurun dan penurunan tersebut dapat dikaitkan secara objektif kepada peristiwa yang terjadi setelah kerugian penurunan nilai diakui, maka kerugian penurunan nilai yang diakui sebelumnya dibalikkan nilainya kepada nilai tercatat aset selama tidak melebihi biaya diamortisasinya pada saat tanggal pembalikkan. Jumlah yang dibalikkan nilainya diakui di dalam laporan laba rugi.

If in a subsequent period, the amount of the impairment loss decreases and the decrease can be related objectively to an event occurring after the impairment was recognized, the previously recognized impairment loss is reversed to the extent the carrying amount of the asset does not exceed its amortized cost at the reversal date. The amount of reversal is recognized in profit or loss.

b) Aset yang dinilai pada biaya perolehan b) Assets carried at cost

Apabila terdapat bukti objektif (seperti memburuknya lingkungan bisnis di mana entitas penerbit menjalankan bisnisnya, kemungkinan ketidakmampuan di dalam membayar atau kesulitan keuangan signifikan entitas penerbit) di mana kerugian penurunan nilai aset keuangan dinilai pada biaya perolehan yang terjadi, jumlah kerugian dihitung sebagai selisih nilai tercatat dan nilai kini arus kas yang didiskontokan pada tingkat pengembalian yang berlaku di pasar untuk aset keuangan yang serupa. Kerugian penurunan nilai tersebut tidakdapat dibalikkan nilainya pada periode selanjutnya.

If there is objective evidence (such as significant adverse changes in the business environment where the issuer operates, probability of insolvency or significant financial difficulties of the issuer) that an impairment loss on financial assets carried at cost has been incurred, the amount of the loss is measured as the difference between the asset's carrying amount and the present value of estimated future cash flows discounted at the current market rate of return for a similar financial asset. Such impairment losses are not reversed in subsequent periods.

c) Aset keuangan tersedia untuk dijual c) Available-for-sale financial assets

Penurunan yang signifikan atau penurunan jangka panjang di dalam nilai wajar lebih rendah dari biaya perolehan, kesulitan keuangan signifikan entitas penerbit atau entitas peminjam, dan hilangnya pasar aktif perdagangan merupakan bukti objektif bahwa investasi ekuitas yang diklasifikasikan sebagai aset keuangan tersedia untuk dijual mungkin mengalami penurunan nilai. Signifikan akan dievaluasi terhadap biaya awal investasi dan jangka panjang terhadap periode di mana nilai wajar telah lebih rendah dari biaya awalnya.

Significant or prolonged decline in fair value below cost, significant financial difficulties of the issuer or obligor, and the disappearance of an active trading market are objective evidence that equity investments classified as available-for-sale financial assets may be impaired. Significant is to be evaluated against the original cost of the investment and prolonged against the period in which the fair value has been below its original cost.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/18 Exhibit E/18

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

(Continued)

f. Instrumen Keuangan (Lanjutan) f. Financial Instruments (Continued)

iv. Penurunan Nilai Aset Keuangan (Lanjutan) iv. Impairment of Financial Assets (Continued)

a) Aset yang dinilai dengan biaya perolehan diamortisasi

a) Assets carried at amortized cost

Untuk aset keuangan yang dinilai pada biaya perolehan diamortisasi, pertama, Grup menilai aset keuangan tersebut secara individual untuk menentukan apakah terdapat bukti penurunan nilai aset keuangan secara individual bagi aset yang signifikan secara individual maupun secara kolektif bagi aset keuangan yang tidak signifikan secara individual. Apabila Grup menentukan tidak terdapat bukti objektif penurunan nilai yang terjadi bagi aset keuangan yang dinilai secara individual, apakah signifikan atau tidak, maka aset tersebut dikategorikan ke dalam aset keuangan yang memiliki karakteristik risiko kredit yang serupa dan menilai aset keuangan tersebut secara kolektif. Aset yang dinilai secara individual untuk penurunan nilai dan di mana kerugian penurunan nilai terjadi, atau melanjutkan untuk diakui, tidak dikategorikan ke dalam penilaian kolektif penurunan nilai.

For financial assets carried at amortized cost, the Group first assesses individually whether objective evidence of impairment exists individually for financial assets that are individually significant, or collectively for financial assets that are not individually significant. If the Group determines that no objective evidence of impairment exists for an individually assessed financial asset, whether significant or not, it includes the asset ina group of financial assets with similar credit risk characteristics and collectively assesses them for impairment. Assets that are individually assessed for impairment and for which an impairment loss is, or continues to be recognized are not included in a collective assessment of impairment.

Apabila terdapat bukti objektif penurunan nilai aset keuangan yang dinilai pada biaya perolehan diamortisasi, telah terjadi, jumlah kerugiannya diukur sebagai selisih antara nilai tercatat aset dan nilai kini diskonto arus kas di masa depan pada suku bunga efektif awal aset keuangan. Apabila suatu pinjaman memiliki suku bunga variabel, maka suku bunga diskonto untuk mengukur semua kerugian penurunan nilai adalah suku bunga efektif. Jumlah tercatat aset dikurangi melalui penggunaan akun penyisihan. Kerugian penurunan nilai diakui di dalam laporan laba-rugi.

If there is objective evidence that an impairment loss on financial assets carried at amortized cost has been incurred, the amount of the loss is measured as the difference between the asset's carrying amount and the present value of estimated future cash flows discounted at the financial asset's original effective interest rate. If a loan has a variable interest rate, the discount rate for measuring any impairment loss is the current effective interest rate. The carrying amount of the asset is reduced through the use of an allowance account. The impairment loss is recognized in profit or loss.

Ketika aset menjadi tidak tertagih, nilai tercatat aset keuangan yang mengalami penurunan nilai langsung dikurangi atau apabila suatu jumlah dibebankan kepada akun penyisihan, jumlah yang dibebankan kepada akun penyisihan dihapuskan terhadap nilai tercatat aset keuangan.

When the asset becomes uncollectible, the carrying amount of impaired financial assets is reduced directly or if an amount was charged to the allowance account, the amounts charged to the allowance account are written off against the carrying value of the financial asset.

Untuk menentukan apakah terdapat bukti objektif bahwa suatu kerugian penurunan nilai aset keuangan telah terjadi, Grup mempertimbangkan faktor-faktor seperti kemungkinan ketidakmampuan untuk membayar atau kesulitan keuangan signifikan debitur dan wanprestasi atau penundaan signifikan di dalam pembayaran.

To determine whether there is objective evidence that an impairment loss on financial assets has been incurred, the Group considers factors such as the probability of insolvency or significant financial difficulties of the debtor and default or significant delay in payments.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/19 Exhibit E/19

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

(Continued)

f. Instrumen Keuangan (Lanjutan) f. Financial Instruments (Continued)

iv. Penurunan Nilai Aset Keuangan (Lanjutan) iv. Impairment of Financial Assets (Continued)

a) Aset yang dinilai dengan biaya perolehan diamortisasi (Lanjutan)

a) Assets carried at amortized cost (Continued)

Apabila di dalam periode berikutnya, jumlah kerugian penurunan nilai menurun dan penurunan tersebut dapat dikaitkan secara objektif kepada peristiwa yang terjadi setelah kerugian penurunan nilai diakui, maka kerugian penurunan nilai yang diakui sebelumnya dibalikkan nilainya kepada nilai tercatat aset selama tidak melebihi biaya diamortisasinya pada saat tanggal pembalikkan. Jumlah yang dibalikkan nilainya diakui di dalam laporan laba rugi.

If in a subsequent period, the amount of the impairment loss decreases and the decrease can be related objectively to an event occurring after the impairment was recognized, the previously recognized impairment loss is reversed to the extent the carrying amount of the asset does not exceed its amortized cost at the reversal date. The amount of reversal is recognized in profit or loss.

b) Aset yang dinilai pada biaya perolehan b) Assets carried at cost

Apabila terdapat bukti objektif (seperti memburuknya lingkungan bisnis di mana entitas penerbit menjalankan bisnisnya, kemungkinan ketidakmampuan di dalam membayar atau kesulitan keuangan signifikan entitas penerbit) di mana kerugian penurunan nilai aset keuangan dinilai pada biaya perolehan yang terjadi, jumlah kerugian dihitung sebagai selisih nilai tercatat dan nilai kini arus kas yang didiskontokan pada tingkat pengembalian yang berlaku di pasar untuk aset keuangan yang serupa. Kerugian penurunan nilai tersebut tidakdapat dibalikkan nilainya pada periode selanjutnya.

If there is objective evidence (such as significant adverse changes in the business environment where the issuer operates, probability of insolvency or significant financial difficulties of the issuer) that an impairment loss on financial assets carried at cost has been incurred, the amount of the loss is measured as the difference between the asset's carrying amount and the present value of estimated future cash flows discounted at the current market rate of return for a similar financial asset. Such impairment losses are not reversed in subsequent periods.

c) Aset keuangan tersedia untuk dijual c) Available-for-sale financial assets

Penurunan yang signifikan atau penurunan jangka panjang di dalam nilai wajar lebih rendah dari biaya perolehan, kesulitan keuangan signifikan entitas penerbit atau entitas peminjam, dan hilangnya pasar aktif perdagangan merupakan bukti objektif bahwa investasi ekuitas yang diklasifikasikan sebagai aset keuangan tersedia untuk dijual mungkin mengalami penurunan nilai. Signifikan akan dievaluasi terhadap biaya awal investasi dan jangka panjang terhadap periode di mana nilai wajar telah lebih rendah dari biaya awalnya.

Significant or prolonged decline in fair value below cost, significant financial difficulties of the issuer or obligor, and the disappearance of an active trading market are objective evidence that equity investments classified as available-for-sale financial assets may be impaired. Significant is to be evaluated against the original cost of the investment and prolonged against the period in which the fair value has been below its original cost.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/21 Exhibit E/21

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES(Continued)

i. Hewan Ternak Produksi - Berumur Pendek i. Livestock

Ayam bibit induk dinyatakan berdasarkan biaya perolehan, ditambah biaya-biaya yang terjadi sampai dengan umur produksi optimal, dan setelah umur tersebut, biaya perolehan dan biaya-biaya yang terjadi pada dikurangi deplesi yang dihitung dengan menggunakan metode satuan unit produksi (production output).

Livestock is carried at cost plus expenses incurred up to optimum production age, and after that age, at cost plus expenses incurred less depletion which is computed based on the unit of production method.

j. Aset Tetap j. Property, Plant and Equipment

Aset tetap menggunakan model biaya yang dinyatakan sebesar biaya perolehan dikurangi akumulasi penyusutan dan akumulasi rugi penurunan nilai. Hak atas tanah tidak disusutkan dan disajikan sebesar biaya perolehan. Penyusutan dihitung dengan menggunakan metode garis lurus berdasarkan taksiran masa manfaat ekonomis aset tetap sebagai berikut:

Property, plant and equipment, after initial recognition, are accounted for by using cost model which carried at cost less their accumulated depreciation and impairment loss. Land rights is not depreciated and carried at cost. Depreciation is computed using straight-line method over the estimated useful life of the assets as follows:

Tahun / Years Bangunan dan prasarana 10-28 Buildings and infrastructuresMesin dan peralatan 10 Machineries and equipmentsPeralatan dan perabot kantor 3-10 Office furniture and fixturesKendaraan bermotor 5 Vehicles

Tanah tidak disusutkan, kecuali: Land is not be depreciated, unless:

(a) Kondisi kualitas tanah tak layak lagi untuk

digunakan dalam operasi utama Perusahaan; (a) The land is no longer viable for use in the

primary operating activity of the entity;

(b) Sifat operasi utama meninggalkan tanah dan bangunan begitu saja apabila proyek selesai; dan

(b) The nature of primary operating activity is such as that the land and building are vacated when the project is completed; and

(c) Prediksi manajemen atau kepastian bahwa

perpanjangan atau pembaharuan hak kemungkinan besar atau pasti tidak diperoleh.

(c) Management's prediction or the probability that extension or renewal of the title is highly unlikely or definitely will not be obtained.

Beban penyusutan diperhitungkan di dalam laporan laba rugi selama tahun buku di mana beban tersebut terjadi.

Depreciation expenses are taken to profit or loss during the financial year in which they are incurred.

Perbaikan dan perawatan diperhitungkan ke dalam laporan laba rugi selama tahun di mana perbaikan dan perawatan terjadi. Biaya renovasi dan restorasi utama digabungkan ke dalam nilai tercatat aset jika biaya tersebut memiliki kemungkinan untuk memberikan manfaat di masa depan yang jumlahnya melebihi standar kinerja pada penilaian awal aset yang ada yang akan mengalir ke dalam Grup dan disusutkan sebesar sisa umur manfaat aset tersebut.

Repair and maintenance expenses are taken to profit or loss during the financial year in which they are incurred. The cost of major renovations and restorations is included in the carrying amount of the asset when it is probable that future economic benefits in excess of the originally assessed standard of performance of the existing asset will flow to the Group, and depreciated over the remaining useful life of the asset.

Nilai sisa, masa manfaat, dan metode depresiasi, di-review pada tiap akhir periode pelaporan, dan disesuaikan secara prosepektif, sesuai dengan keadaan.

The residual value, useful life and depreciation method are reviewed at the end of each reporting period, and adjusted prospectively, if appropriate.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/20 Exhibit E/20

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

(Continued)

f. Instrumen Keuangan (Lanjutan) f. Financial Instruments (Continued)

iv. Penurunan Nilai Aset Keuangan (Lanjutan) iv. Impairment of Financial Assets (Continued)

c) Aset keuangan tersedia untuk dijual (Lanjutan) b) Available-for-sale financial assets (Continued)

Di mana terdapat bukti penurunan nilai, kerugian kumulatif yang diukur sebagai selisih antara biaya perolehan dan nilai wajar kini, dikurangi semua kerugian penurunan nilai pada investasi tersebut yang sebelumnya diakui pada laporan laba rugi dikeluarkan dari pendapatan komprehensif lain dan diakui di dalam laporan laba rugi. Kerugian penurunan nilai pada investasi ekuitas tidak dibalikkan nilainya melalui laporan laba rugi; kenaikan di dalam nilai wajar setelah penurunan nilai diakui langsung di dalam pendapatan komprehensif lainnya.

Where there is evidence of impairment, the cumulative loss measured as the difference between the acquisition cost and the current fair value, less any impairment loss on that investment previously recognized in profit or loss is removed from other comprehensive income and recognized in profit or loss. Impairment losses on equity investments are not reversed through profit or loss; increases in their fair value after impairment are recognized directly in other comprehensive income.

Dalam hal instrumen utang diklasifikasikan sebagai tersedia untuk dijual, penurunan nilai diuji berdasarkan kriteria yang sama dengan aset keuangan yang dinilai berdasarkan biaya perolehan diamortisasi. Namun demikian, jumlah tercatat bagi penurunan nilai adalah kerugian kumulatif yang diukur sebagai selisih antara biaya perolehan diamortisasi dan nilai wajar kini, dikurangi segala kerugian penurunan nilai pada investasi yang sebelumnya diakui di dalam laporan laba rugi. Apabila di dalam tahun berikutnya, nilai wajar instrumen utangmeningkat dan peningkatan tersebut dapat secara objektif dikaitkan dengan peristiwa yang terjadi setelah kerugian penurunan nilai yang diakui di dalam laporan laba rugi, maka kerugian penurunan nilai tersebut dibalikkan nilainya di dalam laporan laba rugi.

In the case of debt instruments classified as available-for-sale, impairment is assessed based on the same criteria as financial assets carried at amortized cost. However, the amount recorded for impairment is the cumulative loss measured as the difference between the amortized cost and the current fair value, less any impairment loss on that investment previously recognized in profit or loss. If in a subsequent year, the fair value of a debt instrument increases and the increases can be objectively related to an event occurring after the impairment loss was recognized in profit or loss, the impairment loss is reversed in profit or loss.

g. Beban Dibayar di Muka g. Prepaid Expenses

Beban dibayar di muka diamortisasi selama masa manfaatnya dengan menggunakan metode garis lurus.

Prepaid expenses are amortized proportionally according to each benefit period by using straight-line method.

h. Persediaan h. Inventories

Persediaan dinyatakan berdasarkan biaya perolehan atau nilai realisasi bersih, mana yang lebih rendah (the lower of cost or net realizable value). Biaya perolehan ditentukan dengan metode rata-rata. Kerusakan atau kehilangan yang ditemukan berdasarkan observasi fisik persediaan berkaitan dengan aktivitas produksi dibebankan pada beban pokok produksi, sedangkan yang tidak berkaitan dengan aktivitas produksi Grup, diakui sebagai keuntungan (kerugian) atas selisih perhitungan persediaan tahun/periode berjalan pada penghasilan (beban) lain-lain.

lnventories are carried at the lower of cost or net realizable value. Cost is determined by using the average method. Damage or loss which has been found based on observation of physical stock taking in relation with production activity is charged to the cost of production, while in not relation with Company's production activity is recognized as gain (loss) on stocktaking difference of inventories in current year to other income (expense).

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/21 Exhibit E/21

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES(Continued)

i. Hewan Ternak Produksi - Berumur Pendek i. Livestock

Ayam bibit induk dinyatakan berdasarkan biaya perolehan, ditambah biaya-biaya yang terjadi sampai dengan umur produksi optimal, dan setelah umur tersebut, biaya perolehan dan biaya-biaya yang terjadi pada dikurangi deplesi yang dihitung dengan menggunakan metode satuan unit produksi (production output).

Livestock is carried at cost plus expenses incurred up to optimum production age, and after that age, at cost plus expenses incurred less depletion which is computed based on the unit of production method.

j. Aset Tetap j. Property, Plant and Equipment

Aset tetap menggunakan model biaya yang dinyatakan sebesar biaya perolehan dikurangi akumulasi penyusutan dan akumulasi rugi penurunan nilai. Hak atas tanah tidak disusutkan dan disajikan sebesar biaya perolehan. Penyusutan dihitung dengan menggunakan metode garis lurus berdasarkan taksiran masa manfaat ekonomis aset tetap sebagai berikut:

Property, plant and equipment, after initial recognition, are accounted for by using cost model which carried at cost less their accumulated depreciation and impairment loss. Land rights is not depreciated and carried at cost. Depreciation is computed using straight-line method over the estimated useful life of the assets as follows:

Tahun / Years Bangunan dan prasarana 10-28 Buildings and infrastructuresMesin dan peralatan 10 Machineries and equipmentsPeralatan dan perabot kantor 3-10 Office furniture and fixturesKendaraan bermotor 5 Vehicles

Tanah tidak disusutkan, kecuali: Land is not be depreciated, unless:

(a) Kondisi kualitas tanah tak layak lagi untuk

digunakan dalam operasi utama Perusahaan; (a) The land is no longer viable for use in the

primary operating activity of the entity;

(b) Sifat operasi utama meninggalkan tanah dan bangunan begitu saja apabila proyek selesai; dan

(b) The nature of primary operating activity is such as that the land and building are vacated when the project is completed; and

(c) Prediksi manajemen atau kepastian bahwa

perpanjangan atau pembaharuan hak kemungkinan besar atau pasti tidak diperoleh.

(c) Management's prediction or the probability that extension or renewal of the title is highly unlikely or definitely will not be obtained.

Beban penyusutan diperhitungkan di dalam laporan laba rugi selama tahun buku di mana beban tersebut terjadi.

Depreciation expenses are taken to profit or loss during the financial year in which they are incurred.

Perbaikan dan perawatan diperhitungkan ke dalam laporan laba rugi selama tahun di mana perbaikan dan perawatan terjadi. Biaya renovasi dan restorasi utama digabungkan ke dalam nilai tercatat aset jika biaya tersebut memiliki kemungkinan untuk memberikan manfaat di masa depan yang jumlahnya melebihi standar kinerja pada penilaian awal aset yang ada yang akan mengalir ke dalam Grup dan disusutkan sebesar sisa umur manfaat aset tersebut.

Repair and maintenance expenses are taken to profit or loss during the financial year in which they are incurred. The cost of major renovations and restorations is included in the carrying amount of the asset when it is probable that future economic benefits in excess of the originally assessed standard of performance of the existing asset will flow to the Group, and depreciated over the remaining useful life of the asset.

Nilai sisa, masa manfaat, dan metode depresiasi, di-review pada tiap akhir periode pelaporan, dan disesuaikan secara prosepektif, sesuai dengan keadaan.

The residual value, useful life and depreciation method are reviewed at the end of each reporting period, and adjusted prospectively, if appropriate.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/23 Exhibit E/23

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

(Continued)

l. S e w a (Lanjutan) l. Leases (Continued)

Tingkat diskonto yang digunakan dalam perhitungan nilai kini dari pembayaran sewa minimum adalah tingkat suku bunga implisit dalam sewa, jika dapat ditentukan dengan praktis, jika tidak, digunakan tingkat suku bunga pinjaman inkremental lessee. Biaya langsung awal yang dikeluarkan lessee ditambahkan ke dalam jumlah yang diakui sebagai aset. Kebijakan penyusutan aset sewaan adalah konsisten dengan aset tetap yang dimiliki sendiri.

Discount rate used to calculate the present value of minimum lease payment is the implicit interest rate of the lease, if practicable, or else at the enterprise's incremental borrowing rate. Any initial direct costs of the lessee are added to the amount recognized as an asset. The depreciation policy for assets held under finance leases should be consistent with that for owned assets.

m. Aset dalam Penyelesaian m. Construction in Progress

Aset dalam penyelesaian merupakan biaya-biaya yang berhubungan secara langsung dengan pembangunan fasilitas dan persiapan aset tetap. Biaya-biaya tersebut termasuk biaya pinjaman yang terjadi selama masa pembangunan yang timbul dari utang yang digunakan untuk pembangunan aset tersebut. Aset dalam penyelesaian dipindahkan ke aset tetap pada saat selesai dan siap digunakan.

Construction in progress represents costs directly associated with the construction of facilities and the preparation of property, plant and equipment for their intended use. These costs include borrowing costs during construction from loans used to construct such assets. Construction in progress is transferred to the respective property, plant and equipment accounts when the construction is substantially completed and is ready for their intended use.

n. Aset Tidak Berwujud n. Intangible Assets

Nilai perolehan aset tidak berwujud yang diperoleh sebagai bagian kombinasi bisnis pada awalnya diakui sesuai nilai wajar pada tanggal akuisisi. Umur manfaat aset tidak berwujud dinilai apakah terbatas atau tidak terbatas. Aset tidak berwujud dengan umur terbatas diamortisasi selama umur manfaat ekonomi dan dievaluasi apabila terdapat indikasi adanya penurunan nilai untuk aset tidak berwujud. Periode dan metode amortisasi untuk aset tidak berwujud dengan umur terbatas ditelaah setidaknya setiap akhir periode pelaporan.

The cost of intangible assets acquired in a business combinations are initially recognized at fair value at the acquisition date. The useful lives of intangible assets are assessed to be either finite or indefinite. Intangible assets with finite lives are amortized over the useful economic life and assessed for impairment whenever there is an indication that the intangible asset may be impaired. The amortization period and the amortization method for an intangible asset with a finite useful life are reviewed at least at the end of each reporting period.

Merek dan hubungan dengan konsumen yang diperoleh sebagai bagian dari kombinasi bisnis mempunyai umur manfaat terbatas masing-masing 15 tahun dan 5 tahun diamortisasi menggunakan metode garis lurus. Dan untuk hak paten mempunyai umur manfaat terbatas 15 tahun.

Brand and customer relationship acquired in a business combination have finite useful lives of 15 years and 5 years, respectively are amortised using the straight-line method. And for patent has finite useful lives of 15 years.

o. Penurunan nilai aset non-keuangan o. Impairment of non-financial assets

Grup menilai pada tiap tanggal pelaporan apakah terdapat indikasi penurunan nilai pada aset. Apabila terdapat indikasi penurunan nilai, atau ketika penilaian penurunan nilai bagi aset secara tahunan disyaratkan, Grup membuat estimasi nilai terpulihkan aset.

The Group assesses at each reporting date whether there is any indication that an asset may be impaired. If any such indication exists, or when annual impairment assessment for an asset is required, the Group makes an estimate of the asset's recoverable amount.

Suatu nilai terpulihkan aset lebih tinggi dibandingkan nilai wajar dikurangi biaya untuk menjual aset atau unit penghasil kas dan nilai pakainya dan ditentukan sebagai suatu aset individual, kecuali aset tersebut tidak menghasilkan arus kas masuk yang sebagian besar independen dari aset lain.

An asset's recoverable amount is the higher of an asset's or cash-generating unit's fair value less costs to sell and its value in use and is determined for an individual asset, unless the asset does not generate cash inflows that are largely independent of those from other assets.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/22 Exhibit E/22

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

(Continued)

j. Aset Tetap (Lanjutan) j. Property, Plant and Equipment (Continued)

Ketika terdapat indikasi penurunan nilai, nilai tercatat aset dinilai dan segera dicatat berdasarkan jumlah terpulihkan. Keuntungan atau kerugian pelepasan aset tetap ditentukan dengan membandingkan penerimaan dengan nilai tercatat dan dicatat ke dalam laba rugi dari operasi.

Where an indication of impairment exists, the carrying amount of the asset is assessed and written down immediately to its recoverable amount. Gains or losses on disposal are determined by comparing proceeds with the carrying amount and are included in profit or loss from operations.

Ketika penggunaan property berubah dari tujuan untuk dimiliki sendiri ke properti investasi, property diukur pada nilai wajar dan direklasifikasi sebagai properti investasi. Segala keuntungan yang timbul dari pengukuran kembali diakui di dalam laporan laba rugi yang dapat membalikkan kerugian penurunan nilai properti spesifik, dengan sisa keuntungan yang diakui di dalam pendapatan komprehensif lain pada cadangan revaluasi dalam ekuitas. Segala kerugian segera diakui langsung di dalam laporan laba rugi.

When the use of a property changes from owner-occupied to investment property, the property is remeasured to fair value and reclassified as investment property. Any gain arising on remeasurement is recognized in profit or loss to the extent that it reverses a previous impairment loss on the specific property, with any remaining gain recognized in other comprehensive income and presented in the revaluation reserve in equity. Any loss is recognized immediately in profit or loss.

k. Aset Tetap yang Tidak Digunakan k. Unutilized Assets

Aset tetap yang tidak digunakan direklasifikasi ke aset tetap yang tidak digunakan terpisah dari aset tetap dan aset ini disusutkan dengan menggunakan metode garis lurus berdasarkan taksiran masa manfaat ekonomis dan disajikan berdasarkan nilai tercatat.

Unutilized assets are reclassified into unutilized assets, separate from property, plant and equipment account, and are depreciated and carried at net book value.

Penyusutan kecuali tanah tidak disusutkan, dihitung dengan menggunakan metode garis lurus berdasarkan taksiran manfaat ekonomis aset tetap sebagai berikut:

Depreciation except for land which is not depreciated, is computed using straight-line method over the estimated useful life of the assets as follows:

Tahun / Years Bangunan dan prasarana 10-28 Buildings and infrastructuresMesin dan peralatan 10 Machineries and equipmentsPeralatan dan perabot kantor 3-10 Office furniture and fixturesKendaraan bermotor 5 Vehicles

l. S e w a l. Leases

Suatu sewa dikelompokkan sebagai sewa pembiayaan jika sewa tersebut mengalihkan secara substansial seluruh risiko dan manfaat yang terkait dengan kepemilikan aset. Suatu sewa dikelompokkan sebagai sewa operasi jika sewa tersebut tidak mengalihkan secara substansial seluruh risiko dan manfaat yang terkait dengan kepemilikan aset.

Leases are categorized as finance leases if it transfer substantially all the risks and rewards incidental to ownership. Leases are categorized as operating leases if it does not transfer substantially all the risks and rewards incidental to ownership.

Pada awal masa sewa, lessee mengakui sewa pembiayaan sebagai aset dan liabilitas dalam neraca konsolidasian sebesar nilai wajar aset sewaan atau sebesar nilai kini dari pembayaran sewa minimum, jika nilai kini lebih rendah dari nilai wajar. Penilaian ditentukan pada awal kontrak.

At commencement of the lease term, finance leases should be recorded as an asset and a liability at the lower of the fair value of the asset and the present value of the minimum lease payments. Each determined at the inception of the lease.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/23 Exhibit E/23

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

(Continued)

l. S e w a (Lanjutan) l. Leases (Continued)

Tingkat diskonto yang digunakan dalam perhitungan nilai kini dari pembayaran sewa minimum adalah tingkat suku bunga implisit dalam sewa, jika dapat ditentukan dengan praktis, jika tidak, digunakan tingkat suku bunga pinjaman inkremental lessee. Biaya langsung awal yang dikeluarkan lessee ditambahkan ke dalam jumlah yang diakui sebagai aset. Kebijakan penyusutan aset sewaan adalah konsisten dengan aset tetap yang dimiliki sendiri.

Discount rate used to calculate the present value of minimum lease payment is the implicit interest rate of the lease, if practicable, or else at the enterprise's incremental borrowing rate. Any initial direct costs of the lessee are added to the amount recognized as an asset. The depreciation policy for assets held under finance leases should be consistent with that for owned assets.

m. Aset dalam Penyelesaian m. Construction in Progress

Aset dalam penyelesaian merupakan biaya-biaya yang berhubungan secara langsung dengan pembangunan fasilitas dan persiapan aset tetap. Biaya-biaya tersebut termasuk biaya pinjaman yang terjadi selama masa pembangunan yang timbul dari utang yang digunakan untuk pembangunan aset tersebut. Aset dalam penyelesaian dipindahkan ke aset tetap pada saat selesai dan siap digunakan.

Construction in progress represents costs directly associated with the construction of facilities and the preparation of property, plant and equipment for their intended use. These costs include borrowing costs during construction from loans used to construct such assets. Construction in progress is transferred to the respective property, plant and equipment accounts when the construction is substantially completed and is ready for their intended use.

n. Aset Tidak Berwujud n. Intangible Assets

Nilai perolehan aset tidak berwujud yang diperoleh sebagai bagian kombinasi bisnis pada awalnya diakui sesuai nilai wajar pada tanggal akuisisi. Umur manfaat aset tidak berwujud dinilai apakah terbatas atau tidak terbatas. Aset tidak berwujud dengan umur terbatas diamortisasi selama umur manfaat ekonomi dan dievaluasi apabila terdapat indikasi adanya penurunan nilai untuk aset tidak berwujud. Periode dan metode amortisasi untuk aset tidak berwujud dengan umur terbatas ditelaah setidaknya setiap akhir periode pelaporan.

The cost of intangible assets acquired in a business combinations are initially recognized at fair value at the acquisition date. The useful lives of intangible assets are assessed to be either finite or indefinite. Intangible assets with finite lives are amortized over the useful economic life and assessed for impairment whenever there is an indication that the intangible asset may be impaired. The amortization period and the amortization method for an intangible asset with a finite useful life are reviewed at least at the end of each reporting period.

Merek dan hubungan dengan konsumen yang diperoleh sebagai bagian dari kombinasi bisnis mempunyai umur manfaat terbatas masing-masing 15 tahun dan 5 tahun diamortisasi menggunakan metode garis lurus. Dan untuk hak paten mempunyai umur manfaat terbatas 15 tahun.

Brand and customer relationship acquired in a business combination have finite useful lives of 15 years and 5 years, respectively are amortised using the straight-line method. And for patent has finite useful lives of 15 years.

o. Penurunan nilai aset non-keuangan o. Impairment of non-financial assets

Grup menilai pada tiap tanggal pelaporan apakah terdapat indikasi penurunan nilai pada aset. Apabila terdapat indikasi penurunan nilai, atau ketika penilaian penurunan nilai bagi aset secara tahunan disyaratkan, Grup membuat estimasi nilai terpulihkan aset.

The Group assesses at each reporting date whether there is any indication that an asset may be impaired. If any such indication exists, or when annual impairment assessment for an asset is required, the Group makes an estimate of the asset's recoverable amount.

Suatu nilai terpulihkan aset lebih tinggi dibandingkan nilai wajar dikurangi biaya untuk menjual aset atau unit penghasil kas dan nilai pakainya dan ditentukan sebagai suatu aset individual, kecuali aset tersebut tidak menghasilkan arus kas masuk yang sebagian besar independen dari aset lain.

An asset's recoverable amount is the higher of an asset's or cash-generating unit's fair value less costs to sell and its value in use and is determined for an individual asset, unless the asset does not generate cash inflows that are largely independent of those from other assets.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/25 Exhibit E/25

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

(Continued)

q. Informasi Segmen (Lanjutan) q. Segment Information (Continued)

c) tersedia informasi keuangan yang dapat dipisahkan.

c) available financial information that can be separated.

Untuk tujuan manajemen segmen operasi berdasarkan produk dan jasa dibagi sebagai berikut:

For management purposes the operating segments based on products and services are divided as follows:

a) Pakan ternak a) Livestock feed b) Ayam umur sehari b) Day old chicks c) Ayam potong c) Dressed chicken d) Kemitraan d) Partnership e) Lain-lain (obat-obatan dan peternakan lainnya) e) Other (medicine and other poultry equipment).

r. Perpajakan r. Taxation

Pajak kini Current tax

Aset dan/ atau liabilitas pajak kini terdiri dari liabilitas kepada, atau klaim dari kantor pelayanan pajak terkait dengan periode kini dan periode sebelumnya pelaporan, yang belum dibayar pada tanggal laporan posisi keuangan konsolidasian.

Current income tax assets and/or liabilities comprise those obligations to, or claims from, tax authorities relating to the current or prior reporting period, that are unpaid at the statement of financial position date.

Pendapatan aset dan/ atau liabilitas pajak dihitung sesuai dengan tarif pajak dan ketentuan perpajakan yang berlaku pada periode fiskal yang terkait, berdasarkan laba kena pajak periode berjalan. Semua perubahan aset atau liabilitas pajak kini diakui sebagai komponen beban pajak penghasilan di dalam laporan laba rugi komprehensif konsolidasian.

Current income tax are calculated according to the tax rates and tax laws applicable to the fiscal periods to which its relate, based on the taxable profit for the period. All changes to current tax assets or liabilities are recognized as a component of income tax expense in the statement of consolidated comprehensive income.

Pajak tangguhan Deferred tax Aset dan liabilitas pajak tangguhan diakui bagi perbedaan temporer antara basis komersial dan basis fiskal aset dan liabilitas pada setiap tanggal pelaporan. Aset pajak tangguhan diakui bagi seluruh perbedaan temporer yang dapat dikurangkan yang memiliki kemungkinan tersedianya laba kena pajak di masa depan terhadap perbedaan temporer yang dapat dikurangkan yang dapat diutilisasi. Liabilitas pajak tangguhan diakui bagi seluruh perbedaan kena pajak temporer. Manfaat pajak di masa depan, seperti saldo rugi fiskal yang belum digunakan juga diakui apabila besar kemungkinan manfaat pajak tersebut dapat direalisasi.

Deferred tax assets and liabilities are recognized for temporary differences between the financial and the tax bases of assets and liabilities at each reporting date. Deferred tax assets are recognized for all deductible temporary differences to the extent that it is probable that future taxable profit will be available against which the deductible temporary difference can be utilized. Deferred tax liabilities are recognized for all taxable temporary differences. Future tax benefits, such as the carry-forward of unused tax losses, are also recognized to the extent that realization of such benefits is probable.

Aset dan liabilitas pajak tangguhan diukur dengan tarif pajak yang diharapkan berlaku pada tahun ketika aset direalisasi atau liabilitas diselesaikan, berdasarkan tarif pajak (dan peraturan perpajakan) yang telah berlaku atau secara substansial berlaku pada tanggal laporan posisi keuangan konsolidasian interim.

Deferred tax assets and liabilities are measured at the tax rates that are expected to apply to the year when the asset is realized or the liability is settled, based on tax rates (and tax laws) that have been enacted or substantially enacted at the interim consolidated statements of financial position date.

Penyesuaian atas liabilitas pajak dicatat pada saat Surat Ketetapan Pajak diterima atau jika mengajukan keberatan dan banding, pada saat keputusan atas keberatan dan banding tersebut diterima.

Amendments to tax obligations are recorded when an assessment letter is received and/or, if objected to and/or appealed against by Group, when the result of the objection and/or appeal is determined.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/24 Exhibit E/24

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

(Continued)

o. Penurunan nilai aset non-keuangan (Lanjutan) o. Impairment of non-financial assets (Continued)

Di dalam menilai nilai pakai, estimasi arus kas yang diharapkan diperoleh dari aset didiskontokan terhadap nilai kininya dengan menggunakan suku bunga diskon sebelum pajak yang mencerminkan penilaian pasar kini terhadap nilai waktu uang dan risiko spesifik aset. Di dalam menilai nilai wajar dikurangi biaya untukmenjual, dibutuhkan model penilaian yang tepat.

In assessing value in use, the estimated future cash flows expected to be generated by the asset are discounted to their present value using a pre- tax discount rate that reflects current market assessments of the time value of money and the risks specific to the asset. In assessing fair value less costs to sell, an appropriate valuation model is used.

Ketika nilai tercatat aset melebihi nilai terpulihkannya, maka aset tersebut dicatat sebesar nilai terpulihkan. Kerugian penurunan nilai diakui di dalam laporan laba rugi kecuali aset yang relevan dinilai pada jumlah yang direvaluasi, yang dalam hal ini kerugian penurunan nilai diperlakukan sebagai penurunan revaluasi.

Where the carrying amount of an asset exceeds its recoverable amount, the asset is written down to its recoverable amount. Impairment losses are recognized in profit or loss unless the relevant asset is carried at a revalued amount, in which case the impairment loss is treated as a revaluation decrease.

Suatu penilaian dilakukan pada setiap tanggal pelaporan untuk mengetahui apakah terdapat suatu indikasi bahwa kerugian penurunan nilai yang diakui sebelumnya sudah tidak ada lagi atau mengalami penurunan. Suatu kerugian penurunan nilai yang diakui sebelumnya, dibalikkan nilainya hanya jika terdapat perubahan atas estimasi yang telah digunakan untuk menentukan nilai terpulihkan aset sejak pengakuan terakhir kerugian penurunan nilai. Apabila demikian kondisinya, nilai tercatat aset dinaikkan kejumlah terpulihkannya. Kenaikan tersebut tidak dapat melebihi nilai tercatat setelah dikurangi penyusutan seandainya tidak ada kerugian penurunan nilai yang diakui sebelumnya. Pembalikkan nilai tersebut diakui di dalam laba rugi kecuali aset tersebut diukur pada jumlah revaluasian, yang dalam hal ini diperlakukan sebagai kenaikan revaluasi.

An assessment is made at each reporting date as to whether there is any indication that previously recognized impairment losses may no longer exist or may have decreased. A previously recognized impairment loss is reversed only if there has been a change in the estimates used to determine the asset's recoverable amount since the last impairment loss was recognized. If that is the case, the carrying amount of the asset is increased to its recoverable amount. That increase cannot exceed the carrying amount that would have been determined, net of depreciation, had no impairment loss been recognized previously. Such reversal is recognized in profit or loss unless the asset is measured at revalued amount, in which case the reversal is treated as a revaluation increase.

p. Pengakuan Pendapatan dan Beban p. Revenue and Expense Recognition

Penjualan diakui pada saat penyerahan barang kepada pelanggan dan hak kepemilikan berpindah kepada pelanggan. Beban diakui sesuai manfaatnya pada tahun/periode yang bersangkutan (accrual basis).

Sales are recognized when the goods are delivered to customers. Expenses are recognized as incurred (accrual basis).

q. Informasi Segmen q. Segment Information

Grup menyajikan segmen operasi sesuai dengan PSAK 5 (Revisi 2009) (lihat Catatan 2a)

The Group presents segment operating in accordance with PSAK No 5 (Revised 2009) (see Note 2a).

Segmen operasi adalah suatu komponen dari entitas: Operating segment is a component of the entity:

a) yang terlibat dalam aktivitas bisnis yang mana

memperoleh pendapatan dan menimbulkan beban (termasuk pendapatan dan beban terkait dengan transaksi dengan komponen lain dari entitas yang sama);

a) business engaged in activities which lead to revenue and expenses (including revenues and expenses relating to transactions with other components of the same entity);

b) hasil operasinya dikaji ulang secara reguler oleh

pengambil keputusan operasional untuk membuat keputusan tentang sumber daya yang dialokasikan pada segmen tersebut dan menilai kinerjanya; dan

b) results of operations are reviewed regularly by operational decision makers to make decisions about the resources allocated to the segment and assess its performance; and

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/25 Exhibit E/25

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

(Continued)

q. Informasi Segmen (Lanjutan) q. Segment Information (Continued)

c) tersedia informasi keuangan yang dapat dipisahkan.

c) available financial information that can be separated.

Untuk tujuan manajemen segmen operasi berdasarkan produk dan jasa dibagi sebagai berikut:

For management purposes the operating segments based on products and services are divided as follows:

a) Pakan ternak a) Livestock feed b) Ayam umur sehari b) Day old chicks c) Ayam potong c) Dressed chicken d) Kemitraan d) Partnership e) Lain-lain (obat-obatan dan peternakan lainnya) e) Other (medicine and other poultry equipment).

r. Perpajakan r. Taxation

Pajak kini Current tax

Aset dan/ atau liabilitas pajak kini terdiri dari liabilitas kepada, atau klaim dari kantor pelayanan pajak terkait dengan periode kini dan periode sebelumnya pelaporan, yang belum dibayar pada tanggal laporan posisi keuangan konsolidasian.

Current income tax assets and/or liabilities comprise those obligations to, or claims from, tax authorities relating to the current or prior reporting period, that are unpaid at the statement of financial position date.

Pendapatan aset dan/ atau liabilitas pajak dihitung sesuai dengan tarif pajak dan ketentuan perpajakan yang berlaku pada periode fiskal yang terkait, berdasarkan laba kena pajak periode berjalan. Semua perubahan aset atau liabilitas pajak kini diakui sebagai komponen beban pajak penghasilan di dalam laporan laba rugi komprehensif konsolidasian.

Current income tax are calculated according to the tax rates and tax laws applicable to the fiscal periods to which its relate, based on the taxable profit for the period. All changes to current tax assets or liabilities are recognized as a component of income tax expense in the statement of consolidated comprehensive income.

Pajak tangguhan Deferred tax Aset dan liabilitas pajak tangguhan diakui bagi perbedaan temporer antara basis komersial dan basis fiskal aset dan liabilitas pada setiap tanggal pelaporan. Aset pajak tangguhan diakui bagi seluruh perbedaan temporer yang dapat dikurangkan yang memiliki kemungkinan tersedianya laba kena pajak di masa depan terhadap perbedaan temporer yang dapat dikurangkan yang dapat diutilisasi. Liabilitas pajak tangguhan diakui bagi seluruh perbedaan kena pajak temporer. Manfaat pajak di masa depan, seperti saldo rugi fiskal yang belum digunakan juga diakui apabila besar kemungkinan manfaat pajak tersebut dapat direalisasi.

Deferred tax assets and liabilities are recognized for temporary differences between the financial and the tax bases of assets and liabilities at each reporting date. Deferred tax assets are recognized for all deductible temporary differences to the extent that it is probable that future taxable profit will be available against which the deductible temporary difference can be utilized. Deferred tax liabilities are recognized for all taxable temporary differences. Future tax benefits, such as the carry-forward of unused tax losses, are also recognized to the extent that realization of such benefits is probable.

Aset dan liabilitas pajak tangguhan diukur dengan tarif pajak yang diharapkan berlaku pada tahun ketika aset direalisasi atau liabilitas diselesaikan, berdasarkan tarif pajak (dan peraturan perpajakan) yang telah berlaku atau secara substansial berlaku pada tanggal laporan posisi keuangan konsolidasian interim.

Deferred tax assets and liabilities are measured at the tax rates that are expected to apply to the year when the asset is realized or the liability is settled, based on tax rates (and tax laws) that have been enacted or substantially enacted at the interim consolidated statements of financial position date.

Penyesuaian atas liabilitas pajak dicatat pada saat Surat Ketetapan Pajak diterima atau jika mengajukan keberatan dan banding, pada saat keputusan atas keberatan dan banding tersebut diterima.

Amendments to tax obligations are recorded when an assessment letter is received and/or, if objected to and/or appealed against by Group, when the result of the objection and/or appeal is determined.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/27 Exhibit E/27

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

(Continued)

u. Laba per Saham Dasar u. Basic Earnings per Share

Laba per saham dihitung dengan membagi laba bersih konsolidasian tahun berjalan dengan rata-rata tertimbang jumlah saham biasa yang beredar pada tahun yang bersangkutan.

Earnings per share are computed by dividing the consolidated profit for the year by the weighted-average number of ordinary shares outstanding during the year.

v. Kuasi-Reorganisasi v. Quasi - Reorganization

Berdasarkan Pernyataan Standar Akuntansi Keuangan (PSAK) No. 51 (Revisi 2003) Akuntansi Kuasi-Reorganisasi, kuasi-reorganisasi merupakan prosedur akuntansi yang mengatur perusahaan merestrukturisasi ekuitasnya dengan menghilangkan defisit dan menilai kembali seluruh aset dan liabilitasnya.

Based on PSAK No. 51 (Revised 2003) "Accounting for Quasi-Reorganization, a quasi-reorganization is an accounting procedure which provides for the Company to restructure its equity by eliminating its deficit and revaluing all of its assets and liabilities.

Aset dan liabilitas dinilai kembali dengan nilai wajar pada tanggal kuasi-reorganisasi. Nilai wajar aset dan liabilitas ditentukan sesuai dengan nilai pasar. Bila nilai pasar tidak tersedia, estimasi nilai wajar didasarkan pada informasi terbaik yang tersedia. Estimasi nilai wajar dilakukan dengan mempertimbangkan harga aset sejenis dan teknik yang paling sesuai dengan karakteristik aset dan liabilitasyang bersangkutan. Nilai wajar aset dan liabilitas pada tanggal kuasi-reorganisasi telah dinilai oleh penilai independen.

Assets and liabilities are revalued using fair value at the date of quasi-reorganization. The fair values of assets and liabilities are determined based on market values. If the fair market value is unavailable, the estimated fair value is determined using the best information available. The estimates of the fair value should put into consideration prices of the similar type of assets and a valuation technique most suitable to the characteristics of the related assets and liabilities. Fair value of the assets and liabilities at the date of quasi-reorganization was appraised by an independent valuer.

Selisih antara nilai wajar aset dan liabilitas dengan nilai bukunya diakui atau dicatat pada akun selisih penilaian aset dan liabilitas. Bila proses penilaian tersebut menyebabkan kenaikan aset bersih, akun selisih penilaian aset dan liabilitas akan digunakan untuk menutup saldo laba negatif.

The difference between fair values of assets and liabilities and their book value shall be recognized and recorded as fair value revaluation difference of assets and liabilities account. If revaluation processresulting to increase in the net assets, difference from fair value revaluation of assets and liabilities account will be eliminated against negative retained earning.

Saldo laba negatif dieliminasi dengan urutan prioritas sebagai berikut:

Negative retained earnings is eliminated in a specific order as follows:

a) cadangan umum; a) general reserve;

b) cadangan khusus; b) special reserve;

c) selisih penilaian aset dan liabilitas dan selisih

penilaian yang sejenisnya; c) difference from revaluations of assets and

liabilities and relevant revaluations;

d) tambahan modal disetor dan sejenisnya; d) additional paid in capital and relevant items;

e) modal saham. e) share capital.

Dengan demikian diharapkan Perusahaan bisa meneruskan usahanya secara lebih baik, seolah-olah mulai dari awal yang baik (fresh start), dengan posisi laporan keuangan yang menunjukkan nilai sekarang dan tanpa dibebani defisit.

Thereby, the Company is expected to continue the operations in a better way, as if it was a fresh start, with a statement of financial position showing current value and without a deficit.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/26 Exhibit E/26

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

(Continued)

r. Perpajakan (Lanjutan) r. Taxation (Continued) Jumlah tercatat aset pajak tangguhan ditelaah pada setiap tanggal laporan posisi keuangan dan diturunkan apabila laba fiskal mungkin tidak memadai untuk mengkompensasi sebagian atau semua aset pajak tangguhan.

The carrying amount of deferred tax assets is reviewed at each statement of financial position date and reduced to the extent that it is no longer probable that sufficient taxable profit will be available to allow all or part of the deferred tax asset to be utilized.

Aset pajak tangguhan yang belum diakui, diukur kembali pada tiap tanggal laporan posisi keuangan dan diakui apabila terdapat kemungkinan pendapatan kena pajak di masa depan memulihkan aset pajak tangguhan.

Unrecognized deferred tax assets are reassessed at each statement of financial position date and are recognized to the extent that it has become probable that future taxable income will allow the deferred tax asset to be recovered.

s. Utang Murabahah s. Murabahah Payables

Utang murabahah merupakan utang yang timbul dari transaksi jual beli yang dilakukan atas dasar Akad Murabahah.

Murabahah payables represent payables arising from the sale and purchase transactions conducted on the basis of Murabahah contract.

Murabahah adalah Akad penjualan untuk barang yang harga beli dan margin-nya telah disepakati oleh pembeli dan penjual dan dibuat eksplisit. Setelah Akad Murabahah, Utang Murabahah diakui sebesar biaya perolehan aktiva Murabahah ditambah margin. Beban Murabahah Ditangguhkan disajikan sebagai pengurang (contra account) Utang Murabahah.

Murabahah is sales contract for goods in which the purchase price and the margin have been agreed by both the buyer and the seller and are made explicit. Upon entering into a Murabahah contract, Murabahah payable is recognized equivalent to the acquisition cost of Murabahah asset plus agreed margin. Murabahah deferred margin expense is presented as a deduction (contra account) of Murabahah Payable.

t. Liabilitas Imbalan Kerja t. Provision for Employee Benefits

Imbalan kerja jangka pendek diakui sebesar jumlah tak terdiskonto ketika pekerja telah memberikan jasanya kepada Grup dalam suatu periode akuntansi.

Short-term employee benefits are recognized at undiscounted amount when an employee has rendered service to Group during an accounting period.

Imbalan pasca kerja diakui sebesar jumlah yang diukur dengan menggunakan dasar diskonto ketika pekerja telah memberikan jasanya kepada perusahaan dalam suatu periode akuntansi. Liabilitas dan beban diukur dengan menggunakan teknik akutaria yang mencakup pula liabilitas konstruktif yang timbul dari praktik kebiasaan perusahaan. Dalam perhitungan liabilitas, imbalan harus didiskontokan dengan menggunakan metode projected unit credit.

Post-employment benefits are recognized at a discounted amount when an employee has rendered service to the Company during an accounting period. Liabilities and expenses are measured using actuarial techniques which include constructive obligation that arises from the Company's informal practices. In calculating the liabilities, benefits should be discounted by using projected unit credit method.

Pesangon pemutusan kontrak kerja diakui jika, dan hanya jika, Grup berkomitmen untuk:

Termination benefits are recognized when, and only when, Group are demonstrably committed to either:

(a) memberhentikan seorang atau sekelompok

pekerja sebelum umur pensiun normal; atau (a) terminate an employee or group of employees

before the normal retirement age; or

(b) menyediakan pesangon bagi pekerja yang menerima penawaran mengundurkan diri secara sukarela.

(b) provide termination benefits as a result of an offer made in order to encourage voluntary redundancy.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/27 Exhibit E/27

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

(Continued)

u. Laba per Saham Dasar u. Basic Earnings per Share

Laba per saham dihitung dengan membagi laba bersih konsolidasian tahun berjalan dengan rata-rata tertimbang jumlah saham biasa yang beredar pada tahun yang bersangkutan.

Earnings per share are computed by dividing the consolidated profit for the year by the weighted-average number of ordinary shares outstanding during the year.

v. Kuasi-Reorganisasi v. Quasi - Reorganization

Berdasarkan Pernyataan Standar Akuntansi Keuangan (PSAK) No. 51 (Revisi 2003) Akuntansi Kuasi-Reorganisasi, kuasi-reorganisasi merupakan prosedur akuntansi yang mengatur perusahaan merestrukturisasi ekuitasnya dengan menghilangkan defisit dan menilai kembali seluruh aset dan liabilitasnya.

Based on PSAK No. 51 (Revised 2003) "Accounting for Quasi-Reorganization, a quasi-reorganization is an accounting procedure which provides for the Company to restructure its equity by eliminating its deficit and revaluing all of its assets and liabilities.

Aset dan liabilitas dinilai kembali dengan nilai wajar pada tanggal kuasi-reorganisasi. Nilai wajar aset dan liabilitas ditentukan sesuai dengan nilai pasar. Bila nilai pasar tidak tersedia, estimasi nilai wajar didasarkan pada informasi terbaik yang tersedia. Estimasi nilai wajar dilakukan dengan mempertimbangkan harga aset sejenis dan teknik yang paling sesuai dengan karakteristik aset dan liabilitasyang bersangkutan. Nilai wajar aset dan liabilitas pada tanggal kuasi-reorganisasi telah dinilai oleh penilai independen.

Assets and liabilities are revalued using fair value at the date of quasi-reorganization. The fair values of assets and liabilities are determined based on market values. If the fair market value is unavailable, the estimated fair value is determined using the best information available. The estimates of the fair value should put into consideration prices of the similar type of assets and a valuation technique most suitable to the characteristics of the related assets and liabilities. Fair value of the assets and liabilities at the date of quasi-reorganization was appraised by an independent valuer.

Selisih antara nilai wajar aset dan liabilitas dengan nilai bukunya diakui atau dicatat pada akun selisih penilaian aset dan liabilitas. Bila proses penilaian tersebut menyebabkan kenaikan aset bersih, akun selisih penilaian aset dan liabilitas akan digunakan untuk menutup saldo laba negatif.

The difference between fair values of assets and liabilities and their book value shall be recognized and recorded as fair value revaluation difference of assets and liabilities account. If revaluation processresulting to increase in the net assets, difference from fair value revaluation of assets and liabilities account will be eliminated against negative retained earning.

Saldo laba negatif dieliminasi dengan urutan prioritas sebagai berikut:

Negative retained earnings is eliminated in a specific order as follows:

a) cadangan umum; a) general reserve;

b) cadangan khusus; b) special reserve;

c) selisih penilaian aset dan liabilitas dan selisih

penilaian yang sejenisnya; c) difference from revaluations of assets and

liabilities and relevant revaluations;

d) tambahan modal disetor dan sejenisnya; d) additional paid in capital and relevant items;

e) modal saham. e) share capital.

Dengan demikian diharapkan Perusahaan bisa meneruskan usahanya secara lebih baik, seolah-olah mulai dari awal yang baik (fresh start), dengan posisi laporan keuangan yang menunjukkan nilai sekarang dan tanpa dibebani defisit.

Thereby, the Company is expected to continue the operations in a better way, as if it was a fresh start, with a statement of financial position showing current value and without a deficit.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/29 Exhibit E/29

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

3. SUMBER ESTIMASI KETIDAK PASTIAN (Lanjutan) 3. SOURCE OF ESTIMATION UNCERTAINTY (Continued)

Klasifikasi Aset dan Liabilitas Keuangan Classification of Financial Assets and Financial Liabilities

Group menetapkan klasifikasi atas aset dan liabilitas tertentu sebagai aset keuangan dan liabilitas keuangan dengan mempertimbangkan bila definisi yang ditetapkan PSAK 55 (Revisi 2006) dipenuhi. Dengan demikian, aset keuangan dan liabilitas keuangan diakui sesuai dengan kebijakan akuntansi Grup seperti diungkapkan padaCatatan 2f.

The Group determines the classifications of certain assets and liabilities as financial assets and financial liabilities by judging if they meet the definitions set forth in PSAK 55 (Revised 2006). Accordingly, the financial assets and financial liabilities are accounted for in accordance with the Group accounting policies disclosed in Note 2f.

Alokasi Harga Beli dan Penurunan Nilai Goodwill Purchase Price Allocation and Goodwill Impairment

Akuntansi akuisisi mensyaratkan penggunaan estimasi akuntansi secara ekstensif dalam mengalokasikan harga beli kepada nilai pasar wajar asset dan liabilitas yang diakuisisi, termasuk aset tak berwujud. Akuisisi bisnis tertentu oleh Grup menimbulkan goodwill. Sesuai PSAK 22 (Revisi 2009), Kombinasi Bisnis, goodwill tidak diamortisasi melainkan diuji bagi penurunan nilai setiap tahunnya. Nilai tercatat goodwill pada tanggal 31 Desember 2011 adalah sebesar Rp 10.890.455.260.

Acquisition accounting requires extensive use of accounting estimates to allocate the purchase price to the fair market values of the assets and liabilities purchased, including intangible assets. Certain business acquisitions of the Group have resulted in goodwill. Under PSAK 22 (Revised 2009), Business Combinations, such goodwill is not amortized but subject to impairment testing. The carrying amount of the Company goodwill as of 31 December 2011 was Rp 10,890,455,260.

Pengujian penurunan nilai dilakukan apabila terdapat indikasi penurunan nilai. Dalam hal ini, goodwill diuji untuk penurunan nilai setiap tahunnya dan jika terdapat indikasi penurunan nilai. Manajemen harus menggunakan pertimbangan dalam mengestimasi jumlah terpulihkan dan menentukan adanya indikasi penurunan nilai.

Impairment test is performed when certain impairment indicators are present. In case of goodwill, such assets are subject to annual impairment test and whenever there is an indication that such asset may be impaired. Management has to use its judgment in estimating the recoverable value and determining if there is any indication of impairment.

Estimasi dan Asumsi Estimates and Assumptions

Asumsi utama masa depan dan sumber utama estimasi ketidakpastian lain pada tanggal pelaporan yang memiliki risiko signifikan bagi penyesuaian yang material terhadap nilai tercatat aset dan liabilitas untuk tahun berikutnya diungkapkan di bawah ini. Grup mendasarkan asumsi dan estimasi pada parameter yang tersedia pada saat laporan keuangan konsolidasian disusun. Asumsi dan situasi mengenai perkembangan masa depan mungkin berubah akibat perubahan pasar atau situasi di luar kendali Grup. Perubahan tersebut dicerminkan dalam asumsi terkait pada saat terjadinya.

The key assumptions concerning the future and other key sources of estimation uncertainty at the reporting date that have a significant risk of causing material adjustments to the carrying amounts of assets and liabilities within the next financial year/period are disclosed below. Group bases its assumptions and estimates on parameters available when the consolidated financial statements are prepared. Existing circumstances and assumptions about future developments may change as a result of market changes or circumstances beyond the control of the Group. Such changes are reflected in the assumptions when they occur.

Penurunan Nilai Piutang Usaha Impairment of Trade Receivables

Grup menilai tiap tanggal laporan posisi keuangan konsolidasian apakah terdapat bukti objektif aset keuangan mengalami penurunan nilai. Untuk menentukanapakah terdapat bukti objektif penurunan nilai, Grup mempertimbangkan faktor-faktor seperti kemungkinan ketidakmampuan untuk membayar utang atau kesulitan signifikan debitur dan kegagalan maupun penundaan signifikan pembayaran. Apabila terdapat bukti objektif penurunan nilai, jumlah dan saat arus kas yang akan datang diestimasi berdasarkan pada pengalaman historis akan kerugian aset dengan karakterisitik risiko kredit yang serupa. Nilai tercatat piutang dagang Grup pada tanggal laporan posisi keuangan konsolidasian diungkapkan di dalam Catatan 6 di dalam laporan keuangan.

The Group assesses at each consolidated statement of financial position date whether there is objective evidence that a financial asset is impaired. To determine whether there is objective evidence of impairment, the Group considers factors such as the possibility of insolvency or significant difficulties of the debtor and default or significant delay in payments. Where there is objective evidence of impairment, the amount and timing of future cash flows are estimated based on historical loss experience for assets with similar credit risk characteristics. The carrying amount of the Group's trade receivables at the consolidated statement of financial position date is disclosed in Note 6 to the financial statements.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/28 Exhibit E/28

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

2. IKHTISAR KEBIJAKAN AKUNTANSI PENTING (Lanjutan) 2. SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES

(Continued)

w. Transaksi dengan pihak-pihak berelasi w. Transactions with Related Parties

Untuk tujuan penyajian laporan keuangan ini, suatu pihak disebut sebagai pihak berelasi terhadap Grup, apabila:

For the purposes of these financial statements, a party is considered to be related to the Group if:

i. Entitas tersebut, baik secara langsung maupun

tak langsung melalui satu atau lebih perantara, untuk mengendalikan Grup atau melakukan pengaruh signifikan terhadap Grup di dalam membuat keputusan kebijakan keuangan dan operasional, atau memiliki pengendalian bersama terhadap Grup;

i. The party has the ability, directly or indirectly through one or more intermediaries, to control the Group or exercise significant influence over the Group in making financial and operating policy decisions, or has joint control over the Group;

ii. Grup dan entitas tersebut adalah subjek

pengendalian bersama; ii. The Group and the party are subject to common

control;

iii. Entitas tersebut adalah entitas asosiasi Grup atau ventura bersama di mana Grup adalah venturer;

iii. The party is an associate of the group or a joint venture in which the Group is a venturer;

iv. Pihak tersebut adalah anggota personel

manajemen kunci atau anggota keluarga dekat individu yang bersangkutan, atau merupakan entitas di bawah pengendalian, pengendalian bersama atau pengaruh signifikan Grup;

iv. The party is a member of the key management personnel of the Group or a close family member of such an individual, or is an entity under the control, joint control or significant influence of the Group;

v. Pihak tersebut adalah anggota keluarga dekat

pihak yang disebut pada butir (i) atau merupakan entitas di bawah pengendalian, pengendalian bersama atau pengaruh signifikan individu tersebut; atau

v. The party is a close family member of a party referred to in (i) or is an entity under the control, joint control or significant influence of such individuals; or

vi. Pihak tersebut merupakan program imbalan pasca

kerja yang merupakan manfaat karyawan atau merupakan entitas yang berelasi dengan pihak berelasi dengan Grup.

vi. The party is a post-employment benefit plan which is for the benefit of employees of the Group or of any entity that is a related party of the Group.

Anggota keluarga dekat merupakan individu anggota keluarga yang diharapkan mempengaruhi, atau dipengaruhi oleh orang, dalam hubungan mereka dengan entitas.

Close family members of an individual are those family members who may be expected to influence, or be influenced by, that individual in their dealings with the entity.

3. SUMBER ESTIMASI KETIDAK PASTIAN 3. SOURCE OF ESTIMATION UNCERTAINTY

Pertimbangan Judgements

Penyusunan laporan keuangan konsolidasian Grup mengharuskan manajemen untuk membuat pertimbangan, estimasi dan asumsi yang mempengaruhi jumlah yang dilaporkan dari pendapatan, beban, aset dan liabilitas, dan pengungkapan atas liabilitas kontinjensi, pada akhir periode pelaporan. Ketidakpastian mengenai asumsi dan estimasi tersebut dapat mengakibatkan penyesuaian material terhadap nilai tercatat aset dan liabilitas yang terpengaruh pada periode pelaporan berikutnya.

The preparation of the Group consolidated financial statements requires management to make judgments, estimates and assumptions that affect the reported amounts of revenues, expenses, assets and liabilities, and the disclosure of contingent liabilities, at the end of the reporting period. Uncertainty about these assumptions and estimates could result in outcomes that may require material adjustments to the carrying amounts of the assets and liabilities affected in future periods.

Pertimbangan berikut ini dibuat oleh manajemen dalam rangka penerapan kebijakan akuntansi Grup yang memiliki pengaruh paling signifikan atas jumlah yang diakui dalam laporan keuangan konsolidasian:

The following judgments are made by management in the process of applying the Group accounting policies that have the most significant effects on the amounts recognized in the consolidated financial statements:

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/29 Exhibit E/29

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

3. SUMBER ESTIMASI KETIDAK PASTIAN (Lanjutan) 3. SOURCE OF ESTIMATION UNCERTAINTY (Continued)

Klasifikasi Aset dan Liabilitas Keuangan Classification of Financial Assets and Financial Liabilities

Group menetapkan klasifikasi atas aset dan liabilitas tertentu sebagai aset keuangan dan liabilitas keuangan dengan mempertimbangkan bila definisi yang ditetapkan PSAK 55 (Revisi 2006) dipenuhi. Dengan demikian, aset keuangan dan liabilitas keuangan diakui sesuai dengan kebijakan akuntansi Grup seperti diungkapkan padaCatatan 2f.

The Group determines the classifications of certain assets and liabilities as financial assets and financial liabilities by judging if they meet the definitions set forth in PSAK 55 (Revised 2006). Accordingly, the financial assets and financial liabilities are accounted for in accordance with the Group accounting policies disclosed in Note 2f.

Alokasi Harga Beli dan Penurunan Nilai Goodwill Purchase Price Allocation and Goodwill Impairment

Akuntansi akuisisi mensyaratkan penggunaan estimasi akuntansi secara ekstensif dalam mengalokasikan harga beli kepada nilai pasar wajar asset dan liabilitas yang diakuisisi, termasuk aset tak berwujud. Akuisisi bisnis tertentu oleh Grup menimbulkan goodwill. Sesuai PSAK 22 (Revisi 2009), Kombinasi Bisnis, goodwill tidak diamortisasi melainkan diuji bagi penurunan nilai setiap tahunnya. Nilai tercatat goodwill pada tanggal 31 Desember 2011 adalah sebesar Rp 10.890.455.260.

Acquisition accounting requires extensive use of accounting estimates to allocate the purchase price to the fair market values of the assets and liabilities purchased, including intangible assets. Certain business acquisitions of the Group have resulted in goodwill. Under PSAK 22 (Revised 2009), Business Combinations, such goodwill is not amortized but subject to impairment testing. The carrying amount of the Company goodwill as of 31 December 2011 was Rp 10,890,455,260.

Pengujian penurunan nilai dilakukan apabila terdapat indikasi penurunan nilai. Dalam hal ini, goodwill diuji untuk penurunan nilai setiap tahunnya dan jika terdapat indikasi penurunan nilai. Manajemen harus menggunakan pertimbangan dalam mengestimasi jumlah terpulihkan dan menentukan adanya indikasi penurunan nilai.

Impairment test is performed when certain impairment indicators are present. In case of goodwill, such assets are subject to annual impairment test and whenever there is an indication that such asset may be impaired. Management has to use its judgment in estimating the recoverable value and determining if there is any indication of impairment.

Estimasi dan Asumsi Estimates and Assumptions

Asumsi utama masa depan dan sumber utama estimasi ketidakpastian lain pada tanggal pelaporan yang memiliki risiko signifikan bagi penyesuaian yang material terhadap nilai tercatat aset dan liabilitas untuk tahun berikutnya diungkapkan di bawah ini. Grup mendasarkan asumsi dan estimasi pada parameter yang tersedia pada saat laporan keuangan konsolidasian disusun. Asumsi dan situasi mengenai perkembangan masa depan mungkin berubah akibat perubahan pasar atau situasi di luar kendali Grup. Perubahan tersebut dicerminkan dalam asumsi terkait pada saat terjadinya.

The key assumptions concerning the future and other key sources of estimation uncertainty at the reporting date that have a significant risk of causing material adjustments to the carrying amounts of assets and liabilities within the next financial year/period are disclosed below. Group bases its assumptions and estimates on parameters available when the consolidated financial statements are prepared. Existing circumstances and assumptions about future developments may change as a result of market changes or circumstances beyond the control of the Group. Such changes are reflected in the assumptions when they occur.

Penurunan Nilai Piutang Usaha Impairment of Trade Receivables

Grup menilai tiap tanggal laporan posisi keuangan konsolidasian apakah terdapat bukti objektif aset keuangan mengalami penurunan nilai. Untuk menentukanapakah terdapat bukti objektif penurunan nilai, Grup mempertimbangkan faktor-faktor seperti kemungkinan ketidakmampuan untuk membayar utang atau kesulitan signifikan debitur dan kegagalan maupun penundaan signifikan pembayaran. Apabila terdapat bukti objektif penurunan nilai, jumlah dan saat arus kas yang akan datang diestimasi berdasarkan pada pengalaman historis akan kerugian aset dengan karakterisitik risiko kredit yang serupa. Nilai tercatat piutang dagang Grup pada tanggal laporan posisi keuangan konsolidasian diungkapkan di dalam Catatan 6 di dalam laporan keuangan.

The Group assesses at each consolidated statement of financial position date whether there is objective evidence that a financial asset is impaired. To determine whether there is objective evidence of impairment, the Group considers factors such as the possibility of insolvency or significant difficulties of the debtor and default or significant delay in payments. Where there is objective evidence of impairment, the amount and timing of future cash flows are estimated based on historical loss experience for assets with similar credit risk characteristics. The carrying amount of the Group's trade receivables at the consolidated statement of financial position date is disclosed in Note 6 to the financial statements.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/31 Exhibit E/31

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

3. SUMBER ESTIMASI KETIDAK PASTIAN (Lanjutan) 3. SOURCE OF ESTIMATION UNCERTAINTY (Continued)

Estimasi dan Asumsi (Lanjutan) Estimates and Assumptions (Continued)

Imbalan Kerja (Lanjutan) Employee Benefits (Continued)

Penentuan liabilitas imbalan kerja karyawan Grup bergantung pada pemilihan asumsi yang digunakan oleh aktuaris independen dalam menghitung jumlah-jumlah tersebut. Asumsi tersebut termasuk antara lain, tingkat diskonto, tingkat kenaikan gaji tahunan, tingkat pengunduran diri karyawan tahunan, tingkat kecacatan, umur pensiun dan tingkat kematian. Keuntungan dan kerugian aktuarial diakui sebagai laba rugi apabila akumulasi neto dari keuntungan dan kerugian aktuarial yang belum diakui pada akhir tahun pelaporan sebelumnya melebihi 10% dari nilai kini liabilitas imbalan pasti pada tanggal tersebut. Sementara Grup berkeyakinan bahwa asumsi tersebut adalah wajar dan sesuai, perbedaan signifikan pada hasil aktual atau perubahan signifikan dalam asumsi yang ditetapkan Grup dapat mempengaruhi secara material liabilitas atas imbalan kerja karyawan dan beban imbalan kerja karyawan neto. Nilai tercatat atas liabilitas imbalan kerja Grup pada tanggal 31 Desember 2011 dan 2010 masing-masing sebesar Rp 50.448.309.706 dan Rp 28.855.676.078. Penjelasan lebih rinci diungkapkan dalam Catatan 26.

The determination of Group employee benefit liabilities is dependent on its selection of certain assumptions used by the independent actuaries in calculating such amounts. Those assumptions include discount rates, future annual salary increase, annual employee turnover rate, disability rate, retirement age and mortality rate. Actuarial gains and losses are recognized as profit or loss when the net cumulative unrecognized actuarial gains and losses at the end of the previous reporting year exceed 10% of the current defined benefit obligation at that date. While Group believes that its assumptions are reasonable and appropriate, significant differences in the Group results or significant changes in the Group assumptions may materially affect its employee benefit liabilities and net employee benefit expenses. The carrying amount of the Group employee benefit liabilities as of 31 December 2011 and 2010 were Rp 50,448,309,706 and Rp 28,855,676,078. Further details are disclosed in Note 26.

Penurunan Nilai Goodwill dan Aset Tak Berwujud Lainnya

Impairment of Goodwill and Other Intangible Assets

Aset tak berwujud selain goodwill, diuji penurunan nilai apabila indikasi penurunan nilai telah terjadi. Untuk goodwill, uji penurunan nilai wajib dilakukan sedikitnya setahun sekali tanpa memperhatikan apakah telah terjadi indikasi penurunan nilai. Penentuan nilai pakai aset tak berwujud membutuhkan estimasi arus kas yang diharapkan akan dihasilkan dari pemakaian berkelanjutan dan pelepasan akhir atas asset tersebut serta tingkat diskonto yang tepat untuk menghitung nilai kini.

Intangible assets, other than goodwill, are reviewed for impairment whenever impairment indicators are present. While for goodwill, impairment testing is required to be performed at least annually irrespective of whether or not there are indications of impairment. Determining the value in use of assets requires the estimation of cash flows expected to be generated from the continued use and ultimate disposition of such assets and a suitable discount rate in order to calculate the present value.

Manajemen berkeyakinan bahwa asumsi-asumsi yang digunakan dalam estimasi nilai pakai dalam laporan keuangan konsolidasian adalah tepat dan wajar, namun demikian, perubahan signifikan dalam asumsi-asumsi tersebut dapat berdampak signifikan pada jumlah nilai terpulihkan dan jumlah kerugian penurunan nilai yang terjadi mungkin berdampak material pada hasil operasi Grup.

While it is believed that the assumptions used in the estimation of the value in use of assets reflected in the consolidated profit and loss are appropriate and reasonable, significant changes in this assumptions may materially affect the assessment of recoverable values and any resulting impairment loss could have a material adverse impact on the results of the Groups operations.

Amortisasi Aset Tak Berwujud Amortization of Intangible Assets

Biaya perolehan aset tak berwujud disusutkan dengan menggunakan metode garis lurus berdasarkan taksiran masa manfaat ekonomisnya.

The cost of intangible assets are depreciated on a straight-line method over their estimated useful lives.

Manajemen mengestimasi masa manfaat ekonomis aset tak berwujud antara 5 sampai dengan 15 tahun. Ini adalah umur yang secara umum diharapkan dalam industri di mana Grup menjalankan bisnisnya. Nilai tercatat bersih atas aset tak berwujud Grup pada tanggal 31 Desember 2011 dan 2010 masing-masing sebesar Rp 34.723.691.462 dan nihil. Penjelasan lebih rinci diungkapkan dalam Catatan 19.

Management estimates the useful lives of such intangible assets to be within 5 to 15 years. These are common life expectancies applied in the industries where the Group conducts its businesses. The net carrying amount of the Groups intangible assets as of 31 December 2011 and 2010 were Rp 34,723,691,462 and nil, respectively. Further details are disclosed in Note 19.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/30 Exhibit E/30

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

3. SUMBER ESTIMASI KETIDAK PASTIAN (Lanjutan) 3. SOURCE OF ESTIMATION UNCERTAINTY (Continued)

Penyusutan Aset Tetap Depreciation of Property, Plant and Equipment

Biaya perolehan aset tetap disusutkan dengan menggunakan metode garis lurus berdasarkan taksiran masa manfaat ekonomisnya dengan memperhitungkan taksiran nilai residu sebesar persentase tertentu dari nilai tercatat, kecuali untuk prasarana tanah. Manajemen mengestimasi masa manfaat ekonomis aset tetap antara 3 sampai dengan 28 tahun. Ini adalah umur yang secaraumum diharapkan dalam industri di mana Grup menjalankan bisnisnya. Perubahan tingkat pemakaian dan perkembangan teknologi dapat mempengaruhi masa manfaat ekonomis dan nilai sisa aset, dan karenanya biaya penyusutan masa depan mungkin direvisi. Nilai tercatat bersih atas aset tetap Grup pada tanggal 31 Desember 2011 dan 2010 masing-masing sebesar Rp 1.272.861.185.548 dan Rp 853.609.651.000. Penjelasan lebih rinci diungkapkan dalam Catatan 15.

The costs of property, plant and equipment, except land, are depreciated on a straight-line basis over their estimated useful lives after taking into account the residual values at as certain percentage of the carrying value, except for land improvements which have no salvage value. Management estimates the useful lives of such property, plant and equipment to be within 3 to 28 years. These are common life expectancies applied in the industries where the Group conducts its businesses. Changes in the expected level of usage and technological development could impact the economic useful lives and the residual values of these assets, necessitating revision of future depreciation charges. The net carrying amount of the Groups property, plant and equipment as of 31 December 2011 and 2010 were Rp 1,272,861,185,548 and 853,609,651,000, respectively. Further details are disclosed in Note 15.

Penyusutan Aset Tetap Yang Tidak Digunakan Depreciation of Unutilized Assets

Biaya perolehan aset tetap yang tidak digunakan disusutkan dengan menggunakan metode garis lurus berdasarkan taksiran masa manfaat ekonomisnya dengan memperhitungkan taksiran nilai residu sebesar persentase tertentu dari nilai tercatat, kecuali untuk prasarana tanah. Manajemen mengestimasi masa manfaat ekonomis aset tetap yang tidak digunakan antara 3 sampai dengan 28 tahun. Ini adalah umur yang secara umum diharapkan dalam industri di mana Grup menjalankan bisnisnya. Perubahan tingkat pemakaian dan perkembangan teknologi dapat mempengaruhi masa manfaat ekonomis dan nilai sisa aset, dan karenanya biaya penyusutan masa depan mungkin direvisi. Nilai tercatat bersih atas aset tetap yang tidak digunakan Grup pada tanggal 31 Desember 2011 dan 2010 masing-masing sebesar Rp 4.780.847.749 dan Rp 8.798.565.454. Penjelasan lebih rinci diungkapkan dalam Catatan 16.

The costs of unutilized assets, except land, are depreciated on a straight-line basis over their estimated useful lives after taking into account the residual values at as certain percentage of the carrying value, except for land improvements which have no salvage value. Management estimates the useful lives of such unutilized assets to be within 3 to 28 years. These are common life expectancies applied in the industries where the Group conducts its businesses. Changes in the expected level of usage and technological development could impact the economic useful lives and the residual values of these assets, necessitating revision of future depreciation charges. The net carrying amount of the Groups unutilized assets as of 31 December 2011 and 2010 were Rp 4,780,847,749 and Rp 8,798,565,454, respectively. Further details are disclosed in Note 16.

Penyisihan Keusangan Persediaan Allowance for Obsolescence of Inventories

Grup melakukan penyisihan bagi persediaan apakah nilai realisasi bersih persediaan menjadi lebih rendah dibandingkan dengan biaya perolehan karena kerusakan, keuzuran fisik, usang, perubahan di dalam tingkat harga atau sebab-sebab lainnya. Akun penyisihan ditelaah untuk mencerminkan penilaian yang akurat di dalam catatan keuangan. Nilai tercatat persediaan di dalam laporan posisi keuangan konsolidasian diungkapkan di dalam Catatan 8 laporan keuangan.

The Group provides allowance for inventories whenever the net realizable value of the inventories becomes lower than cost due to damage, physical deterioration, obsolescence, changes in price levels or other causes. The allowance account is reviewed to reflect the accurate valuation in the financial records. The carrying amount of inventories at the consolidated statement of financial position date is disclosed in Note 8 to the financial statements.

Imbalan Kerja Employee Benefits

Penentuan liabilitas imbalan kerja Grup bergantung pada pemilihan asumsi yang digunakan oleh aktuaris independen dalam menghitung jumlah-jumlah tersebut. Asumsi tersebut termasuk antara lain, tingkat diskonto, tingkat kenaikan gaji tahunan, tingkat pengunduran diri karyawan tahunan, tingkat kecacatan, umur pensiun dan tingkat kematian.

The determination of the Group obligations and cost for pension and employee benefit liabilities is dependent on its selection of certain assumptions used by the independent actuaries in calculating such amounts. Those assumptions include, among others, discount rates, future annual salary increase, annual employee turn-over rate, disability rate, retirement age and mortality rate.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/31 Exhibit E/31

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

3. SUMBER ESTIMASI KETIDAK PASTIAN (Lanjutan) 3. SOURCE OF ESTIMATION UNCERTAINTY (Continued)

Estimasi dan Asumsi (Lanjutan) Estimates and Assumptions (Continued)

Imbalan Kerja (Lanjutan) Employee Benefits (Continued)

Penentuan liabilitas imbalan kerja karyawan Grup bergantung pada pemilihan asumsi yang digunakan oleh aktuaris independen dalam menghitung jumlah-jumlah tersebut. Asumsi tersebut termasuk antara lain, tingkat diskonto, tingkat kenaikan gaji tahunan, tingkat pengunduran diri karyawan tahunan, tingkat kecacatan, umur pensiun dan tingkat kematian. Keuntungan dan kerugian aktuarial diakui sebagai laba rugi apabila akumulasi neto dari keuntungan dan kerugian aktuarial yang belum diakui pada akhir tahun pelaporan sebelumnya melebihi 10% dari nilai kini liabilitas imbalan pasti pada tanggal tersebut. Sementara Grup berkeyakinan bahwa asumsi tersebut adalah wajar dan sesuai, perbedaan signifikan pada hasil aktual atau perubahan signifikan dalam asumsi yang ditetapkan Grup dapat mempengaruhi secara material liabilitas atas imbalan kerja karyawan dan beban imbalan kerja karyawan neto. Nilai tercatat atas liabilitas imbalan kerja Grup pada tanggal 31 Desember 2011 dan 2010 masing-masing sebesar Rp 50.448.309.706 dan Rp 28.855.676.078. Penjelasan lebih rinci diungkapkan dalam Catatan 26.

The determination of Group employee benefit liabilities is dependent on its selection of certain assumptions used by the independent actuaries in calculating such amounts. Those assumptions include discount rates, future annual salary increase, annual employee turnover rate, disability rate, retirement age and mortality rate. Actuarial gains and losses are recognized as profit or loss when the net cumulative unrecognized actuarial gains and losses at the end of the previous reporting year exceed 10% of the current defined benefit obligation at that date. While Group believes that its assumptions are reasonable and appropriate, significant differences in the Group results or significant changes in the Group assumptions may materially affect its employee benefit liabilities and net employee benefit expenses. The carrying amount of the Group employee benefit liabilities as of 31 December 2011 and 2010 were Rp 50,448,309,706 and Rp 28,855,676,078. Further details are disclosed in Note 26.

Penurunan Nilai Goodwill dan Aset Tak Berwujud Lainnya

Impairment of Goodwill and Other Intangible Assets

Aset tak berwujud selain goodwill, diuji penurunan nilai apabila indikasi penurunan nilai telah terjadi. Untuk goodwill, uji penurunan nilai wajib dilakukan sedikitnya setahun sekali tanpa memperhatikan apakah telah terjadi indikasi penurunan nilai. Penentuan nilai pakai aset tak berwujud membutuhkan estimasi arus kas yang diharapkan akan dihasilkan dari pemakaian berkelanjutan dan pelepasan akhir atas asset tersebut serta tingkat diskonto yang tepat untuk menghitung nilai kini.

Intangible assets, other than goodwill, are reviewed for impairment whenever impairment indicators are present. While for goodwill, impairment testing is required to be performed at least annually irrespective of whether or not there are indications of impairment. Determining the value in use of assets requires the estimation of cash flows expected to be generated from the continued use and ultimate disposition of such assets and a suitable discount rate in order to calculate the present value.

Manajemen berkeyakinan bahwa asumsi-asumsi yang digunakan dalam estimasi nilai pakai dalam laporan keuangan konsolidasian adalah tepat dan wajar, namun demikian, perubahan signifikan dalam asumsi-asumsi tersebut dapat berdampak signifikan pada jumlah nilai terpulihkan dan jumlah kerugian penurunan nilai yang terjadi mungkin berdampak material pada hasil operasi Grup.

While it is believed that the assumptions used in the estimation of the value in use of assets reflected in the consolidated profit and loss are appropriate and reasonable, significant changes in this assumptions may materially affect the assessment of recoverable values and any resulting impairment loss could have a material adverse impact on the results of the Groups operations.

Amortisasi Aset Tak Berwujud Amortization of Intangible Assets

Biaya perolehan aset tak berwujud disusutkan dengan menggunakan metode garis lurus berdasarkan taksiran masa manfaat ekonomisnya.

The cost of intangible assets are depreciated on a straight-line method over their estimated useful lives.

Manajemen mengestimasi masa manfaat ekonomis aset tak berwujud antara 5 sampai dengan 15 tahun. Ini adalah umur yang secara umum diharapkan dalam industri di mana Grup menjalankan bisnisnya. Nilai tercatat bersih atas aset tak berwujud Grup pada tanggal 31 Desember 2011 dan 2010 masing-masing sebesar Rp 34.723.691.462 dan nihil. Penjelasan lebih rinci diungkapkan dalam Catatan 19.

Management estimates the useful lives of such intangible assets to be within 5 to 15 years. These are common life expectancies applied in the industries where the Group conducts its businesses. The net carrying amount of the Groups intangible assets as of 31 December 2011 and 2010 were Rp 34,723,691,462 and nil, respectively. Further details are disclosed in Note 19.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/33 Exhibit E/33

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

4. KOMBINASI BISNIS YANG SIGNIFIKAN (Lanjutan) 4. SIGNIFICANT BUSINESS COMBINATION (Continued)

Berikut jumlah yang dibayarkan untuk perolehan akuisisi PT Belfoods Indonesia, nilai wajar atas asset dan liabilitas dan kepentingan non pengendali pada tanggal akusisi:

The following summaries paid for acquired PT Belfood Indonesia, fair value asset and liabilities and non-controlling interest at the acquisition date:

Nilai konversi utang menjadi kepemilikan saham

sebagai nilai akuisisi

59.680.578.837 Conversion value of the debt into shares as

acquisition value Kepentingan Non-Pengendali yang dikuisisi 24.041.826.829 Non-controlling Interest Acquired Jumlah 83.722.405.666 Total

Tabel berikut merangkum jumlah asset teridentifikasi yang diperoleh, liabilitas yang diambil-alih dan kepentingan nonpengendali pada tanggal akuisisi:

The following table summaries amounts of the identifiable assets acquired, the liabilities assumed and non-controlling interests at the acquisition date:

Kas dan bank 1.550.015.679 Cash and banks Piutang usaha 36.029.620.712 Trade receivables Piutang lainnya 11.915.786.623 Other receivables Persediaan 24.393.007.428 Inventories Uang muka 1.592.022.618 Advances Pajak dibayar dimuka 582.821.063 Prepaid taxes Biaya dibayar dimuka 1.446.312.105 Prepaid expenses Investasi Saham 5.940.000 Investment in stock Tanah 12.247.300.000 Land Bangunan 17.733.950.000 Building Mesin dan Perlengkapan 30.688.290.000 Machine and equipments Inventaris Kantor 5.277.969.776 Office, furniture and fixture Kendaraan 3.844.743.777 Vehicles Aset pajak tangguhan 175.860.100 Deferred tax assets Aset lain-lain 2.148.199.455 Other assets Aset tak berwujud 35.033.873.958 Intangible Assets Utang bank jangka pendek ( 20.000.000.000) Short-term bank loans Utang usaha ( 64.362.597.060) Other payables Utang lain-lain ( 8.064.545.569) Other payables Uang muka diterima ( 18.939.808) Advances received Utang pajak ( 1.327.036.268) Taxes payables Biaya masih harus dibayar ( 7.214.690.618) Accrued expenses Utang bank jangka panjang ( 2.050.098.687) Long-term bank loans Liabilitas diestimasi imbalan kerja ( 8.795.854.878) Provision for employee benefits Nilai wajar dari aset bersih yang diperoleh 72.831.950.406 Fair value of net assets required

Harga pembelian 83.722.405.666 Purchase priceNilai wajar dari aset bersih yang diperoleh 72.831.950.406 Fair value of net assets required

Goodwill yang timbul dari akuisisi 10.890.455.260 Goodwill arising from acquisition

Nilai wajar piutang usaha sebesar Rp 36.029.620.712 dengan jumlah kontraktual bruto piutang usaha yang telah jatuh tempo sebesar Rp 37.077.269.944 dimana sebesar Rp 1.047.649.232 diperkirakan tidak dapat ditagih.

The fair value of trade receivables is Rp 36,029,620,712 which gross contractual amount for trade receivables due is Rp 37,077,269,944, of which Rp 1,047,649,232 is expected to be uncollectible.

Goodwill sebesar Rp 10.890.455.260 timbul dari beberapa faktor skala ekonomis dan sinergi yang akan diperoleh Grup sehubungan dengan terintegrasinya industri pengolahan makanan asal unggas yang dapat diwujudkan.

The Goodwill of Rp 10,890,455,460 arises from a number of factors such as expected scale of economies and synergies obtained by the Group in line with the realization of integrated poultry-based food business.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/32 Exhibit E/32

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

3. SUMBER ESTIMASI KETIDAK PASTIAN (Lanjutan) 3. SOURCE OF ESTIMATION UNCERTAINTY (Continued)

Estimasi dan Asumsi (Lanjutan) Estimates and Assumptions (Continued)

Pajak Penghasilan Income Tax

Pertimbangan signifikan dilakukan dalam menentukan penyisihan atas pajak penghasilan badan. Terdapat transaksi dan perhitungan tertentu yang penentuan pajak akhirnya adalah tidak pasti sepanjang kegiatan usaha normal. Grup mengakui liabilitas atas pajak penghasilan badan berdasarkan estimasi apakah akan terdapat tambahan pajak penghasilan badan.

Significant judgment is involved in determining the provision for corporate income tax. There are certain transactions and computation for which the ultimate tax determination is uncertain during the ordinary course of business. The Group recognizes liabilities for expected corporate income tax issues based on estimates of whether additional corporate income tax will be due.

Realisasi dari Aset Pajak Tangguhan Realization of Deferred Income Tax Assets

Grup melakukan penelaahan atas nilai tercatat asset pajak tangguhan pada setiap akhir periode pelaporan dan mengurangi nilai tersebut sampai sebesar kemungkinan asset tersebut tidak dapat direalisasikan, dimana penghasilan kena pajak yang tersedia memungkinkan untuk penggunaan seluruh atau sebagian dari aset pajak tangguhan tersebut. Penelaahan Grup atas pengakuan asset pajak tangguhan untuk perbedaan temporer yang dapat dikurangkan, didasarkan atas tingkat dan waktu dari penghasilan kena pajak yang ditaksirkan untuk periode pelaporan berikutnya. Taksiran ini berdasarkan hasil pencapaian Grup di masa lalu dan ekspektasi di masa depan terhadap pendapatan dan beban, sebagaimana juga dengan strategi perencanaan perpajakan di masa depan. Tetapi tidak terdapat kepastian bahwa Grup dapat menghasilkan penghasilan kena pajak yang cukup untuk memungkinkan penggunaan sebagian atau seluruh bagian dari asset pajak tangguhan tersebut.

Group reviews the carrying amounts of deferred income tax assets at the end of each reporting period and reduces these to the extent that it is no longer probable that sufficient taxable income will be available to allow all or part of the deferred income tax assets to be utilized. The Group assessment of the recognition of deferred income tax assets for deductible temporary differences is based on the level and timing of forecast taxable income for the subsequent reporting periods. This forecast is based on the Groups past results and future expectations as to revenues and expenses as well as future tax planning strategies. However, there is no assurance that the Group will generate sufficient taxable income to allow all or part of deferred income tax assets to be utilized.

4. KOMBINASI BISNIS YANG SIGNIFIKAN 4. SIGNIFICANT BUSINESS COMBINATION

Berdasarkan keputusan Rapat Umum Pemegang Saham Luar Biasa Perusahaan pada tanggal 30 Juni 2009, yang telah dituangkan dalam akta berita acara nomor 188, telah disetujui pengambilalihan (akuisisi) saham dalam PT Belfoods Indonesia (BI) sebanyak 596.806 saham dengan harga saham Rp 100.000 per saham dengan cara konversi utang menjadi kepemilikan saham (debt to equity swap). Kepemilikan saham tersebut berasal dari utangPT Belfoods Indonesia sebanyak Rp 59.680.578.837 kepada Grup.

Based on deeds of Company's Extraordinary General Meeting of Shareholders decision No. 188 dated 30 June 2009, it was approved the acquisition of share in PT Belfoods Indonesia (BI) of 596.806 shares with share price of Rp 100,000 each, by converting debt into shares (debt to equity swap). Ownership of these shares was from PT Belfoods Indonesias debt to group amounting to Rp 59,680,578,837 to Group.

Pada tanggal 28 Oktober 2011, Grup mengakuisisi 66,99% dari modal saham PT Belfoods Indonesia dan memperoleh kontrol atas PT Belfoods Indonesia, sebuah industri pengolahan makanan beku.

On 28 October 2011, Group acquired 66,99% of the share capital of PT Belfood Indonesia and obtained control of PT Belfood Indonesia, a frozen food processing industry.

Grup mengakusisi PT Belfoods Indonesia dengan tujuan memperpanjang rantai integrasi bisnis dan mewujudkan visi: To be the leading integrated poultry-based food company in Indonesia

Group acquired PT Belfood Indonesia for the purpose of extending the chain of business integration and realize the vision: "To be the leading integrated poultry-based food company in Indonesia"

Nilai wajar aset dan liabilitas yang diperoleh didasarkan pada penilaian oleh penilai independen. Nilai wajar asset dan liabilitas teridentifikasi lainnya mendekati nilai tercatat pada tanggal akuisisi.

The fair value of assets and liabilities are based on a valuation by an independent valuer. The fair value of other identifiable assets and liabilities approximates their carrying value at the date of acquisition.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/33 Exhibit E/33

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

4. KOMBINASI BISNIS YANG SIGNIFIKAN (Lanjutan) 4. SIGNIFICANT BUSINESS COMBINATION (Continued)

Berikut jumlah yang dibayarkan untuk perolehan akuisisi PT Belfoods Indonesia, nilai wajar atas asset dan liabilitas dan kepentingan non pengendali pada tanggal akusisi:

The following summaries paid for acquired PT Belfood Indonesia, fair value asset and liabilities and non-controlling interest at the acquisition date:

Nilai konversi utang menjadi kepemilikan saham

sebagai nilai akuisisi

59.680.578.837 Conversion value of the debt into shares as

acquisition value Kepentingan Non-Pengendali yang dikuisisi 24.041.826.829 Non-controlling Interest Acquired Jumlah 83.722.405.666 Total

Tabel berikut merangkum jumlah asset teridentifikasi yang diperoleh, liabilitas yang diambil-alih dan kepentingan nonpengendali pada tanggal akuisisi:

The following table summaries amounts of the identifiable assets acquired, the liabilities assumed and non-controlling interests at the acquisition date:

Kas dan bank 1.550.015.679 Cash and banks Piutang usaha 36.029.620.712 Trade receivables Piutang lainnya 11.915.786.623 Other receivables Persediaan 24.393.007.428 Inventories Uang muka 1.592.022.618 Advances Pajak dibayar dimuka 582.821.063 Prepaid taxes Biaya dibayar dimuka 1.446.312.105 Prepaid expenses Investasi Saham 5.940.000 Investment in stock Tanah 12.247.300.000 Land Bangunan 17.733.950.000 Building Mesin dan Perlengkapan 30.688.290.000 Machine and equipments Inventaris Kantor 5.277.969.776 Office, furniture and fixture Kendaraan 3.844.743.777 Vehicles Aset pajak tangguhan 175.860.100 Deferred tax assets Aset lain-lain 2.148.199.455 Other assets Aset tak berwujud 35.033.873.958 Intangible Assets Utang bank jangka pendek ( 20.000.000.000) Short-term bank loans Utang usaha ( 64.362.597.060) Other payables Utang lain-lain ( 8.064.545.569) Other payables Uang muka diterima ( 18.939.808) Advances received Utang pajak ( 1.327.036.268) Taxes payables Biaya masih harus dibayar ( 7.214.690.618) Accrued expenses Utang bank jangka panjang ( 2.050.098.687) Long-term bank loans Liabilitas diestimasi imbalan kerja ( 8.795.854.878) Provision for employee benefits Nilai wajar dari aset bersih yang diperoleh 72.831.950.406 Fair value of net assets required

Harga pembelian 83.722.405.666 Purchase priceNilai wajar dari aset bersih yang diperoleh 72.831.950.406 Fair value of net assets required

Goodwill yang timbul dari akuisisi 10.890.455.260 Goodwill arising from acquisition

Nilai wajar piutang usaha sebesar Rp 36.029.620.712 dengan jumlah kontraktual bruto piutang usaha yang telah jatuh tempo sebesar Rp 37.077.269.944 dimana sebesar Rp 1.047.649.232 diperkirakan tidak dapat ditagih.

The fair value of trade receivables is Rp 36,029,620,712 which gross contractual amount for trade receivables due is Rp 37,077,269,944, of which Rp 1,047,649,232 is expected to be uncollectible.

Goodwill sebesar Rp 10.890.455.260 timbul dari beberapa faktor skala ekonomis dan sinergi yang akan diperoleh Grup sehubungan dengan terintegrasinya industri pengolahan makanan asal unggas yang dapat diwujudkan.

The Goodwill of Rp 10,890,455,460 arises from a number of factors such as expected scale of economies and synergies obtained by the Group in line with the realization of integrated poultry-based food business.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/35 Exhibit E/35

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

6. PIUTANG USAHA (Lanjutan) 6. TRADE RECEIVABLES (Continued)

Mutasi penyisihan kerugian penurunan nilai: Movement of allowance for impairment losses:

2 0 1 1 2 0 1 0 Saldo awal 133.297.182.419 126.052.725.268 Beginning Balance Penerapan awal PSAK 55 - 8.741.559.531 First time adoption of PSAK 55 Penambahan 6.455.236.391 10.205.614.072 Additions Pengurangan ( 3.744.220.728) ( 11.702.716.452) Deductions Saldo akhir 136.008.198.082 133.297.182.419 Ending Balance

Manajemen berkeyakinan bahwa jumlah cadangan penurunan nilai tersebut cukup untuk menutup kemungkinan kerugian atas tidak tertagihnya piutang usaha.

Management believes that the allowance for impairment is adequate to cover possible losses from the uncollectible accounts receivable trade.

2 0 1 1 2 0 1 0 Rincian umur piutang sejak Details of aging receivables based on

tanggal faktur: invoice dates are: Sampai dengan 1 bulan 190.381.345.767 184.644.087.575 Up to 1 month > 1 bulan 2 bulan 15.779.341.400 11.552.321.175 > 1 month 2 month > 2 bulan 3 bulan 10.091.029.472 4.165.337.878 > 2 month 3 month > 3 bulan 246.337.827.764 301.456.888.951 > 3 month Saldo akhir 462.589.544.403 501.818.635.579 Ending balance

Seluruh piutang usaha adalah kepada pihak ketiga, dan tidak terdapat piutang usaha kepada pihak-pihak berelasi. Seluruh piutang usaha dalam mata uang Rupiah.

All receivables are from third parties and there is no receivable from related parties. All accounts receivable are denominated in Rupiah.

Piutang usaha milik Grup masing-masing sebesar Rp 554.717.009.000 dan Rp 361.717.009.000 pada tahun 2011 dan 2010 digunakan sebagai jaminan atas fasilitas pinjaman bank jangka pendek dan jangka panjang yang diperoleh Grup (lihat catatan 22, 23 dan 24)

Trade receivables of Group amounting to Rp 554,717,009,000 and Rp 361,717,009,000 in 2011 and 2010, respectivelly are used as collateral for short-term and long-term bank loans obtained by the Group (See Notes 22, 23 and 24)

7. PIUTANG LAIN-LAIN 7. OTHER RECEIVABLES

2 0 1 1 2 0 1 0 PT Cipta Kreasi Windriya Usaha 3.380.000.000 - PT Cipta Kreasi Windriya UsahaPT Era Cepat Transportindo 2.222.920.000 - PT Era Cepat TransportindoKaryawan 4.897.754.753 4.781.498.575 Employees receivableWendys International Corporation 3.481.691.220 4.470.000.000 Wendys lnternational CorporationPT Belfoods Indonesia - 8.000.000.000 PT Belfoods IndonesiaLainnya 11.691.079.027 2.662.073.660 Miscellaneous Jumlah 25.673.445.000 19.913.572.235 Total

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/34 Exhibit E/34

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

5. KAS DAN SETARA KAS 5. CASH AND CASH EQUIVALENTS

Akun ini terdiri dari: This account consists of:

2 0 1 1 2 0 1 0 Kas Cash on hand Rupiah 1.724.334.637 1.288.260.724 Rupiah US Dolar 13.955.652 15.131.853 US Dollar 1.738.290.289 1.303.392.577 Bank Cash in banks Rupiah Rupiah PT Bank Negara Indonesia (Persero) Tbk 13.691.110.016 2.027.225.528 PT Bank Negara Indonesia (Persero) Tbk PT Bank Bukopin Tbk 11.668.164.182 87.046.967 PT Bank Bukopin Tbk PT Bank Central Asia Tbk 11.628.879.282 6.234.869.144 PT Bank Central Asia Tbk PT Bank Mandiri (Persero) Tbk 4.078.672.866 71.811.750 PT Bank Mandiri (Persero) Tbk PT Bank Syariah Mandiri 495.987.479 86.019.607 PT Bank Syariah Mandiri PT Bank Permata Tbk 55.982.017 55.982.017 PT Bank Permata Tbk PT Bank Rakyat Indonesia (Persero) Tbk 47.045.979 10.330.354 PT Bank Rakyat Indonesia (Persero) Tbk PT Bank CIMB Niaga Tbk 7.850.879 9.743.991 PT Bank CIMB Niaga Tbk US Dolar US Dollar PT Bank Bukopin Tbk 290.181.858 - PT Bank Bukopin Tbk PT Bank Central Asia Tbk 63.300.353 258.464.367 PT Bank Central Asia Tbk Raiffeisen Bank International 44.836.815 139.420.740 Raiffeisen Bank International PT Bank Negara Indonesia (Persero) Tbk 94.154.132 55.136.229 PT Bank Negara Indonesia (Persero) Tbk 42.166.165.858 9.036.050.694 Deposito berjangka Time deposit Rupiah Rupiah PT Bank Negara Indonesia (Persero) Tbk 4.847.000.000 25.995.000.000 PT Bank Negara Indonesia (Persero) Tbk PT Bank Rakyat Indonesia (Persero) Tbk 1.978.000.000 - PT Bank Rakyat Indonesia (Persero) Tbk 6.825.000.000 25.995.000.000 Jumlah 50.729.456.147 36.334.443.271 T o t a l

2 0 1 1 2 0 1 0

Tingkat suku bunga deposito berjangka : 4% p.a 5,20% p.a : The annual interest rate on time deposit Jangka waktu : 3 hari/days 3 hari/days : Period

Tidak terdapat saldo kas dan setara kas pada pihak-pihak berelasi.

There is no cash balance and cash equivalents in the related parties.

6. PIUTANG USAHA 6. TRADE RECEIVABLES

Piutang usaha berdasarkan jenis penjualan/kegiatan usaha adalah:

Details of accounts receivable by nature of its sales/operating activity are as follows:

2 0 1 1 2 0 1 0 Piutang penjualan Pakan ternak 258.676.304.418 271.090.625.563 Receivable from sales Feedmill Piutang penjualan Ayam umur sehari 85.871.131.398 92.493.615.215 Receivable from sales - Day old chickens Piutang penjualan Ayam beku Receivable from sales - Dressed

dan makanan beku 58.597.647.310 122.345.224.565 chicken and frozen foods Piutang penjualan Lainnya 59.444.461.277 15.889.170.236 Receivable from sales Others 462.589.544.403 501.818.635.579 Dikurangi: Penyisihan kerugian

penurunan nilai ( 136.008.198.082) ( 133.297.182.419) Less: Allowance for impairment losses Jumlah 326.581.346.321 368.521.453.160 Total

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/35 Exhibit E/35

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

6. PIUTANG USAHA (Lanjutan) 6. TRADE RECEIVABLES (Continued)

Mutasi penyisihan kerugian penurunan nilai: Movement of allowance for impairment losses:

2 0 1 1 2 0 1 0 Saldo awal 133.297.182.419 126.052.725.268 Beginning Balance Penerapan awal PSAK 55 - 8.741.559.531 First time adoption of PSAK 55 Penambahan 6.455.236.391 10.205.614.072 Additions Pengurangan ( 3.744.220.728) ( 11.702.716.452) Deductions Saldo akhir 136.008.198.082 133.297.182.419 Ending Balance

Manajemen berkeyakinan bahwa jumlah cadangan penurunan nilai tersebut cukup untuk menutup kemungkinan kerugian atas tidak tertagihnya piutang usaha.

Management believes that the allowance for impairment is adequate to cover possible losses from the uncollectible accounts receivable trade.

2 0 1 1 2 0 1 0 Rincian umur piutang sejak Details of aging receivables based on

tanggal faktur: invoice dates are: Sampai dengan 1 bulan 190.381.345.767 184.644.087.575 Up to 1 month > 1 bulan 2 bulan 15.779.341.400 11.552.321.175 > 1 month 2 month > 2 bulan 3 bulan 10.091.029.472 4.165.337.878 > 2 month 3 month > 3 bulan 246.337.827.764 301.456.888.951 > 3 month Saldo akhir 462.589.544.403 501.818.635.579 Ending balance

Seluruh piutang usaha adalah kepada pihak ketiga, dan tidak terdapat piutang usaha kepada pihak-pihak berelasi. Seluruh piutang usaha dalam mata uang Rupiah.

All receivables are from third parties and there is no receivable from related parties. All accounts receivable are denominated in Rupiah.

Piutang usaha milik Grup masing-masing sebesar Rp 554.717.009.000 dan Rp 361.717.009.000 pada tahun 2011 dan 2010 digunakan sebagai jaminan atas fasilitas pinjaman bank jangka pendek dan jangka panjang yang diperoleh Grup (lihat catatan 22, 23 dan 24)

Trade receivables of Group amounting to Rp 554,717,009,000 and Rp 361,717,009,000 in 2011 and 2010, respectivelly are used as collateral for short-term and long-term bank loans obtained by the Group (See Notes 22, 23 and 24)

7. PIUTANG LAIN-LAIN 7. OTHER RECEIVABLES

2 0 1 1 2 0 1 0 PT Cipta Kreasi Windriya Usaha 3.380.000.000 - PT Cipta Kreasi Windriya UsahaPT Era Cepat Transportindo 2.222.920.000 - PT Era Cepat TransportindoKaryawan 4.897.754.753 4.781.498.575 Employees receivableWendys International Corporation 3.481.691.220 4.470.000.000 Wendys lnternational CorporationPT Belfoods Indonesia - 8.000.000.000 PT Belfoods IndonesiaLainnya 11.691.079.027 2.662.073.660 Miscellaneous Jumlah 25.673.445.000 19.913.572.235 Total

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/37 Exhibit E/37

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

8. PERSEDIAAN (Lanjutan) 8. INVENTORIES (Continued)

Mutasi penyisihan kerugian penurunan nilai persediaan adalah sebagai berikut:

The movements of allowance for declining value of inventories are as follows:

2 0 1 1 2 0 1 0 Saldo awal 5.649.296.856 - Beginning Balance Penyisihan tahun berjalan 15.292.511.871 18.054.416.371 Provision during the year Pemulihan penyisihan tahun berjalan ( 19.280.347.415) ( 12.405.119.515) Reversal of allowance during the year Saldo akhir 1.661.461.312 5.649.296.856 Ending Balance

Berdasarkan hasil penelaahan atas kondisi persediaan pada akhir tahun, manajemen berkeyakinan bahwa jumlah penyisihan penurunan nilai persediaan tersebut cukup untuk menutup kemungkinan kerugian atas penurunan nilai persediaan.

Based on the review of the condition of the inventories at the end of the year, the management believes that the allowance for decline in value of inventories is adequate to cover possible losses from the decline in value of these inventories.

9. HEWAN TERNAK PRODUKSI - BERUMUR PENDEK 9. LIVESTOCK

2 0 1 1 2 0 1 0 Telah menghasilkan Mature (productive)Saldo awal 45.943.816.000 46.263.379.111 Beginning balance Pembelian - 16.184.338.754 Purchase of parent stockReklasifikasi dari ayam belum Reclassification from immature

menghasilkan 104.056.733.364 81.819.822.592 livestock Beban deplesi ( 109.124.631.827 ) ( 98.323.724.457 ) Depletion cost Saldo Akhir 40.875.917.537 45.943.816.000 Ending balance Belum menghasilkan Immature (not yet productive)Saldo Awal 29.978.434.072 20.262.153.276 Beginning balance Kapitalisasi biaya 179.779.179.700 91.536.103.388 Capitalized costReklasifikasi ke ayam telah Reclassification to mature (productive)

menghasilkan ( 104.056.733.364 ) ( 81.819.822.592 ) livestock Saldo Akhir 105.700.880.408 29.978.434.072 Ending balance Jumlah 146.576.797.945 75.922.250.072 Total

Beban deplesi dari ayam pembibit induk yang telah menghasilkan dibebankan dalam tahun berjalan sebagai beban pokok penjualan.

Depletion of mature parent stock is charged in current year as part of cost of goods sold.

10. PAJAK DIBAYAR MUKA 10. PREPAID TAXES

2 0 1 1 2 0 1 0 Pajak Penghasilan Income Tax Perusahaan The Company Pasal 28 2010 - 5.930.387.769 Article 28 2010 Entitas anak Subsidiaries Pasal 28-A - 48.293.384 Article 28-A - 5.978.681.153

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/36 Exhibit E/36

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

7. PIUTANG LAIN-LAIN (Lanjutan) 7. OTHER RECEIVABLES (Continued)

Berdasarkan Surat Kesepakatan, tanggal 1 Juli 2009, Perusahaan memberikan pinjaman tanpa bunga kepada PT Belfoods Indonesia sejumlah Rp 8 milyar dengan jangka waktu pengembalian selama 1 tahun terhitung sejak Surat Kesepakatan tersebut ditandatangani.

Based on Letter of Agreement, dated 1 July 2009, the Company provided a non-interest bearing loan to PT Belfoods Indonesia amounted Rp 8 billion with maturity date in one year effective from the date of agreement was signed.

Pada tanggal 28 Oktober 2011, Grup mengakuisisi 66,99% dari modal saham PT Belfoods Indonesia dan memperoleh kontrol atas PT Belfoods Indonesia, sebuah industri pengolahan makanan beku. (lihat catatan 4)

On 28 October 2011, Group acquired 66,99% share capital of PT Belfoods Indonesia and obtained control of PT Belfoods Indonesia, a frozen food processing industry.(see Note 4)

8. PERSEDIAAN 8. INVENTORIES

2 0 1 1 2 0 1 0 Barang jadi Finished GoodsPakan ternak 29.159.393.669 24.220.854.011 FeedsAyam beku dan makanan beku 21.828.121.769 15.406.215.521 Dressed chicken and frozen foodVaksin, obat-obatan ternak

dan lainnya 7.956.870.786 6.005.143.016 Vaccine, medicines and othersAlat-alat peternakan 3.290.076.214 1.947.284.641 Poultry equipments Sub jumlah 62.234.462.438 47.579.497.189 Sub total Barang dalam proses 41.795.588.151 39.880.717.913 Work in process Raw materials and supportingBahan baku dan pembantu materials Bahan baku 401.784.665.421 277.596.722.542 Raw materiaisBahan kemasan 8.746.673.970 4.728.089.437 Packaging materialsSuku cadang dan bahan pembantu Spare parts and other indirect

lainnya 38.749.278.875 41.367.806.577 materials Sub jumlah 449.280.618.266 323.692.618.556 Sub total Barang dalam perjalanan 983.446.010 61.793.985.966 Goods in transit Jumlah 554.294.114.865 472.946.819.624 Total Penyisihan penurunan nilai persediaan ( 1.661.461.312) ( 5.649.296.856

)

Allowance for decline in value of Inventories

Bersih 552.632.653.553 467.297.522.768 Net

Persediaan telah diasuransikan secara gabungan dengan aset tetap (lihat Catatan 15) terhadap segala risiko, khusus untuk persediaan, masing-masing dengan jumlah pertanggungan sebesar USD 70.451.752 dan Rp 142.798.767.408 pada tahun 2011 serta sebesar USD 34.171.287 dan Rp 70.781.562.712 pada tahun 2010. Manajemen berpendapat bahwa jumlah pertanggungan tersebut di atas cukup untuk menutup kemungkinan kerugian yang timbul.

The inventories of the Company are insured collectively with property, plant and equipment (see Note 15) against all risk, special for inventories, with a total insurance coverage of USD 70,451,752 and 142,798,767,408 in 2011and USD 34,171,287 and Rp 70,781,562,712 in 2010. Management believes that the sum insured is adequate to cover any possible losses.

Persediaan milik Grup masing-masing sebesar Rp 782.545.000.000 dan USD 12.500.000 pada tahun 2011 dan Rp 432.545.000.000 dan USD 12.500.000 pada tahun 2010 digunakan sebagai jaminan atas pinjaman bank jangka pendek dan jangka panjang yang diperoleh Grup.(lihat catatan 22, 23 dan 24).

Inventories of the Group amounting to Rp 782,545,000,000 and USD 12,500,000 in 2011 and Rp 432,545,000,000 and USD 12,500,000 in 2010 are used as collateral for short-term and long-term bank loans obtained by the Group (See Notes 22, 23 and 24)

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/37 Exhibit E/37

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

8. PERSEDIAAN (Lanjutan) 8. INVENTORIES (Continued)

Mutasi penyisihan kerugian penurunan nilai persediaan adalah sebagai berikut:

The movements of allowance for declining value of inventories are as follows:

2 0 1 1 2 0 1 0 Saldo awal 5.649.296.856 - Beginning Balance Penyisihan tahun berjalan 15.292.511.871 18.054.416.371 Provision during the year Pemulihan penyisihan tahun berjalan ( 19.280.347.415) ( 12.405.119.515) Reversal of allowance during the year Saldo akhir 1.661.461.312 5.649.296.856 Ending Balance

Berdasarkan hasil penelaahan atas kondisi persediaan pada akhir tahun, manajemen berkeyakinan bahwa jumlah penyisihan penurunan nilai persediaan tersebut cukup untuk menutup kemungkinan kerugian atas penurunan nilai persediaan.

Based on the review of the condition of the inventories at the end of the year, the management believes that the allowance for decline in value of inventories is adequate to cover possible losses from the decline in value of these inventories.

9. HEWAN TERNAK PRODUKSI - BERUMUR PENDEK 9. LIVESTOCK

2 0 1 1 2 0 1 0 Telah menghasilkan Mature (productive)Saldo awal 45.943.816.000 46.263.379.111 Beginning balance Pembelian - 16.184.338.754 Purchase of parent stockReklasifikasi dari ayam belum Reclassification from immature

menghasilkan 104.056.733.364 81.819.822.592 livestock Beban deplesi ( 109.124.631.827 ) ( 98.323.724.457 ) Depletion cost Saldo Akhir 40.875.917.537 45.943.816.000 Ending balance Belum menghasilkan Immature (not yet productive)Saldo Awal 29.978.434.072 20.262.153.276 Beginning balance Kapitalisasi biaya 179.779.179.700 91.536.103.388 Capitalized costReklasifikasi ke ayam telah Reclassification to mature (productive)

menghasilkan ( 104.056.733.364 ) ( 81.819.822.592 ) livestock Saldo Akhir 105.700.880.408 29.978.434.072 Ending balance Jumlah 146.576.797.945 75.922.250.072 Total

Beban deplesi dari ayam pembibit induk yang telah menghasilkan dibebankan dalam tahun berjalan sebagai beban pokok penjualan.

Depletion of mature parent stock is charged in current year as part of cost of goods sold.

10. PAJAK DIBAYAR MUKA 10. PREPAID TAXES

2 0 1 1 2 0 1 0 Pajak Penghasilan Income Tax Perusahaan The Company Pasal 28 2010 - 5.930.387.769 Article 28 2010 Entitas anak Subsidiaries Pasal 28-A - 48.293.384 Article 28-A - 5.978.681.153

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/39 Exhibit E/39

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

12. INVESTASI PADA PERUSAHAAN ASOSIASI (Lanjutan) 12. INVESTMENT IN ASSOCIATE (Continued)

Sampai dengan tanggal penyelesaian laporan keuangankonsolidasian, tidak terdapat transaksi material dan belum ada rencana manajemen entitas anak yang signifikan terkait dengan investasi pada Perusahaan asosiasi ini.

Up to reporting date of the consolidated financial statements, there is no material transaction and the subsidiary significant management plan related to investment in this associate.

13. INVESTASI JANGKA PANJANG LAINNYA - Bersih 13. OTHER LONG-TERM INVESTMENTS Net

Akun ini merupakan efek yang tersedia untuk dijual, terdiri dari:

This account represents securities available-for-sale, consisting of:

2 0 1 1 2 0 1 0

Portofolio investasi pada: lnvestment portfolio in:Surat berharga komersial yang

diterbitkan oleh: Commercial paper issued by:PT Jakarta Bakery 5.940.000 - PT Jakarta Bakery

Dikurangi : penyisihan penurunan Less : Allowance for permanent nilai permanen ( 5.940.000 ) - decline

Bersih - - Net Surat berharga komersial yang

diterbitkan oleh: Commercial paper issued by:PT Perkebunan Nusantara XI 49.150.000.000 49.150.000.000 PT Perkebunan Nusantara XI

Dikurangi : penyisihan penurunan Less : Allowance for permanent nilai permanen ( 49.150.000.000) ( 49.150.000.000) decline

Bersih - - Net

Jumlah - - T o t a l

Surat berharga komersial yang diterbitkan oleh PT Perkebunan Nusantara XI melalui Eraska Grup, sebagai agen penerbit, merupakan hasil pengalihan piutang Perusahaan, kepada PT Sietek Nusantara Finance (SNF) pada tahun 1998 sesuai dengan perjanjian tanggal 16 Pebruari 1998. Menurut manajemen Perusahaan, surat berharga komersial tersebut sebelumnya dimiliki oleh SNF dan tidak dapat direalisasikan pelunasannya saat jatuh tempo pada tanggal 26 Desember 1997.

The Company received Commercial Papers issued by PT Perkebunan Nusantara XI through the Eraska Group as issuing agent, as settlement of the Company's receivables from PT Sietek Nusantara Finance (SNF) in 1998 based on the agreement dated 16 February 1998. According to the Company's management, the commercial Papers were previously owned by SNF and were not paid by the issuer when mature on 26 December 1997.

Investasi pada PT Perkebunan Nusantara XI sampai dengan tanggal penyelesaian laporan keuangan konsolidasian ini, tidak ada rencana manajemen Perusahaan yang signifikan untuk perolehan kembali investasi ini. Manajemen Perusahaan juga telah membentuk penyisihan penurunan nilai permanen atasnya.

Investment in PT Perkebunan Nusantara XI, up to reporting date, there is no significant management's plan specifically intended to recover this investment. The management of the Company had provided the allowance for permanent decline on these investments.

PT Belfoods Indonesia (entitas anak) memiliki investasi saham pada PT Jakarta Bakery dengan kepemilikan saham sebesar 99%. PT Jakarta Bakery memiliki jumlah aset sebesar Rp 5.940.000. PT Belfoods Indonesia tidak menkonsolidasikan laporan keuangan PT Jakarta Bakery karena perusahaan tersebut tidak aktif.

PT Belfoods Indonesia (the subsidiary) has investment in share in PT Jakarta Bakery with 99% ownership. PT Jakarta Bakery has total asset amounted Rp 5,940,000. PT Belfoods Indonesia does not consolidate the PT Jakarta Bakerys Financial Statements because it is a dorman company.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/38 Exhibit E/38

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

10. PAJAK DIBAYAR MUKA (Lanjutan) 10. PREPAID TAXES (Continued)

2 0 1 1 2 0 1 0 Pajak Pertambahan Nilai Value Added Tax Perusahaan - - The Company Entitas anak 1.215.920.916 1.044.982.603 Subsidiaries

1.215.920.916 1.044.982.603 Jumlah 1.215.920.916 7.023.663.756 Total

11. UANG MUKA PEMBELIAN 11. ADVANCE PURCHASES

2 0 1 1 2 0 1 0 Uang muka pembelian persediaan Advances for purchases of

Import (USD) 79.716.486.377 46.681.625.237 Import (USD) Lokal (Rupiah) 16.865.982.890 7.327.799.401 Domestic (Rupiah)

Uang muka pembelian lain-lain (Rupiah) 7.141.530.507 1.590.809.441 Advance for other purchases (Rupiah)

Jumlah 103.723.999.774 55.600.234.079 Total

Uang muka pembelian persediaan merupakan uang muka pembelian persediaan bahan baku dari pemasok antara lain berupa corn, bungkil kedelai, corn glutten meal, jagung local dan jagung Argentina.

Advances for inventories purchases represent advances for purchase of raw materials both locally and imported from third party such as for corn, soyabean meal, corn glutten meal, domestic corn, Argentinean corn and Argentinean SBM.

12. INVESTASI PADA PERUSAHAAN ASOSIASI 12. INVESTMENT IN ASSOCIATE

Akun ini merupakan investasi PT Sierad Pangan Nusantara (SPN), entitas anak, dalam bentuk saham PT Bridor Indonesia sebesar Rp 1.300.839.000 atau ekuivalen 25% dari modal disetor PT Bridor Indonesia. PT Bridor Indonesia bergerak dalam bidang industri dan distribusi makanan. Entitas anak tidak mempunyai pengaruh yang cukup signifikan dalam PT Bridor Indonesia karenanya investasi dicatat sebesar harga perolehan. Pada tahun 2003 atas permohonan SPN, Pengadilan Negeri Bekasi menunjuk akuntan independen dengan penetapan No.105/Pdt.P/2002/ PN.BKS untuk melakukan special audit atas laporan keuangan PT Bridor Indonesia untuk tahun buku 1998, 1999, 2000, 2001 dan sebagian 2002, sehubungan adanya kelalaian PT Bridor Indonesia dalam memberikan laporan keuangan tahunan kepada SPN selaku pemegang saham sehingga kinerja PT Bridor Indonesia tidak dapat dipantau.

This account represents the investment of PT Sierad Pangan Nusantara (SPN), a subsidiary, in shares of stockof PT Bridor lndonesia (BI) amounted to Rp 1,300,839,000 or equivalent 25% of paid in capital of PT Bridor Indonesia. PT Bridor Indonesia's business is in food industry and distribution. The subsidiary had no signficant influence over PT Bridor Indonesia, accordingly the investment is recorded at acquisition cost. In 2003, at a request by SPN, the Court of Justice of Bekasi appointed an independent accountant under decision No. 105/Pdt.P/2002/ PN.BKS to conduct a special audit on the financial statements of PT Bridor Indonesia for 1998, 1999, 2000, 2001 and part of 2002, in relation with the failure of PT Bridor lndonesia to provide their financial statements to SPN as stockholder, with the effect that the performance of PT Bridor lndonesia can not be monitored by SPN.

Berdasarkan laporan akuntan tersebut dalam laporannya tanggal 16 Juli 2003, PT Bridor Indonesia sejak awal beroperasi sampai dengan pertengahan tahun 2002 mengalami kerugian yang mengakibatkan defisiensi modal, yang pada gilirannya akan berdampak pada kelangsungan usahanya. Sejak tahun 2003, investasi ini diturunkan nilainya menjadi nihil.

Based on the accountants' report dated 16 July 2003, PT Bridor lndonesia from the commencement of its operations until the middle of 2002 has suffered losses which resulted in capital deficiency, and affected its ability to continue as a going concern. Since 2003, this investment value has been reduced to be nil.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/39 Exhibit E/39

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

12. INVESTASI PADA PERUSAHAAN ASOSIASI (Lanjutan) 12. INVESTMENT IN ASSOCIATE (Continued)

Sampai dengan tanggal penyelesaian laporan keuangankonsolidasian, tidak terdapat transaksi material dan belum ada rencana manajemen entitas anak yang signifikan terkait dengan investasi pada Perusahaan asosiasi ini.

Up to reporting date of the consolidated financial statements, there is no material transaction and the subsidiary significant management plan related to investment in this associate.

13. INVESTASI JANGKA PANJANG LAINNYA - Bersih 13. OTHER LONG-TERM INVESTMENTS Net

Akun ini merupakan efek yang tersedia untuk dijual, terdiri dari:

This account represents securities available-for-sale, consisting of:

2 0 1 1 2 0 1 0

Portofolio investasi pada: lnvestment portfolio in:Surat berharga komersial yang

diterbitkan oleh: Commercial paper issued by:PT Jakarta Bakery 5.940.000 - PT Jakarta Bakery

Dikurangi : penyisihan penurunan Less : Allowance for permanent nilai permanen ( 5.940.000 ) - decline

Bersih - - Net Surat berharga komersial yang

diterbitkan oleh: Commercial paper issued by:PT Perkebunan Nusantara XI 49.150.000.000 49.150.000.000 PT Perkebunan Nusantara XI

Dikurangi : penyisihan penurunan Less : Allowance for permanent nilai permanen ( 49.150.000.000) ( 49.150.000.000) decline

Bersih - - Net

Jumlah - - T o t a l

Surat berharga komersial yang diterbitkan oleh PT Perkebunan Nusantara XI melalui Eraska Grup, sebagai agen penerbit, merupakan hasil pengalihan piutang Perusahaan, kepada PT Sietek Nusantara Finance (SNF) pada tahun 1998 sesuai dengan perjanjian tanggal 16 Pebruari 1998. Menurut manajemen Perusahaan, surat berharga komersial tersebut sebelumnya dimiliki oleh SNF dan tidak dapat direalisasikan pelunasannya saat jatuh tempo pada tanggal 26 Desember 1997.

The Company received Commercial Papers issued by PT Perkebunan Nusantara XI through the Eraska Group as issuing agent, as settlement of the Company's receivables from PT Sietek Nusantara Finance (SNF) in 1998 based on the agreement dated 16 February 1998. According to the Company's management, the commercial Papers were previously owned by SNF and were not paid by the issuer when mature on 26 December 1997.

Investasi pada PT Perkebunan Nusantara XI sampai dengan tanggal penyelesaian laporan keuangan konsolidasian ini, tidak ada rencana manajemen Perusahaan yang signifikan untuk perolehan kembali investasi ini. Manajemen Perusahaan juga telah membentuk penyisihan penurunan nilai permanen atasnya.

Investment in PT Perkebunan Nusantara XI, up to reporting date, there is no significant management's plan specifically intended to recover this investment. The management of the Company had provided the allowance for permanent decline on these investments.

PT Belfoods Indonesia (entitas anak) memiliki investasi saham pada PT Jakarta Bakery dengan kepemilikan saham sebesar 99%. PT Jakarta Bakery memiliki jumlah aset sebesar Rp 5.940.000. PT Belfoods Indonesia tidak menkonsolidasikan laporan keuangan PT Jakarta Bakery karena perusahaan tersebut tidak aktif.

PT Belfoods Indonesia (the subsidiary) has investment in share in PT Jakarta Bakery with 99% ownership. PT Jakarta Bakery has total asset amounted Rp 5,940,000. PT Belfoods Indonesia does not consolidate the PT Jakarta Bakerys Financial Statements because it is a dorman company.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/41 Exhibit E/41

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

14. PAJAK PENGHASILAN (Lanjutan) 14. INCOME TAX (Continued)

a. Beban Pajak Penghasilan (Lanjutan) a. lncome Tax Expenses (Continued)

2 0 1 1 2 0 1 0 Beban pajak penghasilan: Income tax expense : (2011) 20% x Rp 45.765.793.000 9.153.158.600 - (2011) 20% x Rp 45,703,884,000 (2010) 20% x Rp 86.610.421.000 - 17.322.084.200 (2010) 20% x Rp 86,610,421,000

Jumlah beban pajak penghasilan 9.153.158.600 17.322.084.200 Total income tax expense

Dikurangi kredit pajak: Less credit taxes: Pajak Penghasilan Pasal 25 250.000.000 - Income Tax Article 25 Pajak Penghasilan Pasal 22 21.767.879.000 23.252.471.969 Income Tax Article 22

22.017.879.000 23.252.471.969

Pajak penghasilan badan - Corporate income tax - lebih bayar 12.864.720.400 5.930.387.769 over payment

Beban pajak penghasilan - kini lncome tax expense currentPerusahaan 9.153.158.600 17.322.084.200 The CompanyEntitas anak 1.056.433.815 652.992.775 Subsidiaries Jumlah 10.209.592.415 17.975.076.975 Total

b. Aset (Liabilitas) Pajak Tangguhan b. Deferred Tax Assets (Liabilities)

Rincian aset (liabilitas) pajak tangguhan adalah sebagai berikut :

Details of the deffered tax assets (liabilities) are as follows :

Dikreditkan/ (dibebankan) ke laporan laba rugi komprensif konsolidasian/ Credited(charged) Perolehan to consolidated entitas anak/ statement of Acquisition of comprehensive 2 0 1 0 Subsidiary Income 2 0 1 1

Aset pajak tangguhan Deferred tax assets of thePerusahaan Company

Penyisihan kerugian penurunan nilai 26.114.491.830 - 366.876.651 26.481.368.481

Allowance for impairment losses

Aset sewa pembiayaan ( 1.114.430.747) - ( 418.914.999)( 1.533.345.746) LeasingPerbedaan penyusutan Different between book

komersial dan fiskal ( 3.545.545.968) - ( 464.356.630)( 4.009.902.598) and tax depreciation Liabilitas Provision of employee

imbalan kerja 5.683.551.801 - 2.472.232.769 8.155.784.570 Benefits Amortization of financial

Amortisasi biaya finansial ( 173.010.978) - ( 1.134.470.587)( 1.307.481.565) Charges

Aset pajak tangguhan Deferred tax assets of thePerusahaan-bersih 26.965.055.938 - 821.367.204 27.786.423.142 Company-net

Aset pajak tangguhan Deferred tax assets of

entitas anak - bersih 755.588.810 175.860.100 66.905.474 998.354.384 the subsidiaries net Aset pajak tangguhan -

bersih 27.720.644.748 175.860.100 888.272.678 28.784.777.526 Deferred tax assets net Liabilitas pajak

tangguhan Deferred tax liabilitiesentitas anak ( 101.035.464) - ( 1.239.314.895)( 1.340.350.359) of the subsidiaries

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/40 Exhibit E/40

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

14. PAJAK PENGHASILAN 14. INCOME TAX

a. Beban Pajak Penghasilan a. lncome Tax Expenses

2 0 1 1 2 0 1 0

Kini CurrentPerusahaan ( 9.153.158.600) ( 17.322.084.200 ) The CompanyEntitas anak ( 1.056.433.815) ( 652.992.775) The Subsidiaries ( 10.209.592.415) ( 17.975.076.975) Tangguhan DeferredPerusahaan 821.367.202 ( 13.779.528.924) The CompanyEntitas anak ( 1.172.409.421) ( 206.384.993) The Subsidiaries

( 351.042.219) ( 13.985.913.917)

Beban Pajak Penghasilan - Bersih ( 10.560.634.634) ( 31.960.990.892) Income Tax Expense Net

Rekonsiliasi antara laba sebelum pajak penghasilan menurut laporan laba rugi komprehensif konsolidasian dengan laba fiskal konsolidasianadalah sebagai berikut:

A reconciliation of the income before income tax between the consolidated statements of comprensive income and the consolidated taxable income tax is as follows:

2 0 1 1 2 0 1 0

Perusahaan The CompanyLaba konsolidasian sebelum pajak 34.012.901.098 93.121.354.766 Consolidated income before income tax Eliminasi konsolidasi 1.537.921.244 - Condolidation eliminationsDikurangi : (Laba) rugi Anak Less: (Income) loss of the

perusahaan ( 4.901.126.676 ) ( 676.508.754 ) Subsidiaries

Laba komersial Perusahaan 30.649.695.666 92.444.846.012 The Companys taxable income

Beda Temporer: Temporary Differences: Depreciation of property, plant and Penyusutan aset tetap dan aset equipment and assets under

sewa pembiayaan ( 839.704.002) ( 10.750.817.925) finance lease Angsuran sewa pembiayaan Finance lease expense with

dengan hak opsi ( 2.094.574.993) ( 2.742.231.944) option right Penyisihan uang jasa 12.361.163.843 4.589.825.503 Provision for employee benefitsPenyisihan dan penghapusan Allowance for doubtful receivables

piutang usaha 1.834.383.255 ( 2.669.307.758) and written-off Amortisasi biaya pendanaan ( 5.672.352.944) ( 865.054.891) Amortization of financing charges 5.588.915.159 ( 12.437.587.015)

Beda Tetap: Permanent Differences:Penghasilan tidak kena pajak ( 765.545.043) ( 189.932.616) Non-taxable incomeBeban yang bukan merupakan

pengurang pajak 10.292.726.771 6.793.094.716 Non deductible expenses 9.527.181.728 6.603.162.100

Laba kena pajak 45.765.792.553 86.610.421.097 Taxable income

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/41 Exhibit E/41

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

14. PAJAK PENGHASILAN (Lanjutan) 14. INCOME TAX (Continued)

a. Beban Pajak Penghasilan (Lanjutan) a. lncome Tax Expenses (Continued)

2 0 1 1 2 0 1 0 Beban pajak penghasilan: Income tax expense : (2011) 20% x Rp 45.765.793.000 9.153.158.600 - (2011) 20% x Rp 45,703,884,000 (2010) 20% x Rp 86.610.421.000 - 17.322.084.200 (2010) 20% x Rp 86,610,421,000

Jumlah beban pajak penghasilan 9.153.158.600 17.322.084.200 Total income tax expense

Dikurangi kredit pajak: Less credit taxes: Pajak Penghasilan Pasal 25 250.000.000 - Income Tax Article 25 Pajak Penghasilan Pasal 22 21.767.879.000 23.252.471.969 Income Tax Article 22

22.017.879.000 23.252.471.969

Pajak penghasilan badan - Corporate income tax - lebih bayar 12.864.720.400 5.930.387.769 over payment

Beban pajak penghasilan - kini lncome tax expense currentPerusahaan 9.153.158.600 17.322.084.200 The CompanyEntitas anak 1.056.433.815 652.992.775 Subsidiaries Jumlah 10.209.592.415 17.975.076.975 Total

b. Aset (Liabilitas) Pajak Tangguhan b. Deferred Tax Assets (Liabilities)

Rincian aset (liabilitas) pajak tangguhan adalah sebagai berikut :

Details of the deffered tax assets (liabilities) are as follows :

Dikreditkan/ (dibebankan) ke laporan laba rugi komprensif konsolidasian/ Credited(charged) Perolehan to consolidated entitas anak/ statement of Acquisition of comprehensive 2 0 1 0 Subsidiary Income 2 0 1 1

Aset pajak tangguhan Deferred tax assets of thePerusahaan Company

Penyisihan kerugian penurunan nilai 26.114.491.830 - 366.876.651 26.481.368.481

Allowance for impairment losses

Aset sewa pembiayaan ( 1.114.430.747) - ( 418.914.999)( 1.533.345.746) LeasingPerbedaan penyusutan Different between book

komersial dan fiskal ( 3.545.545.968) - ( 464.356.630)( 4.009.902.598) and tax depreciation Liabilitas Provision of employee

imbalan kerja 5.683.551.801 - 2.472.232.769 8.155.784.570 Benefits Amortization of financial

Amortisasi biaya finansial ( 173.010.978) - ( 1.134.470.587)( 1.307.481.565) Charges

Aset pajak tangguhan Deferred tax assets of thePerusahaan-bersih 26.965.055.938 - 821.367.204 27.786.423.142 Company-net

Aset pajak tangguhan Deferred tax assets of

entitas anak - bersih 755.588.810 175.860.100 66.905.474 998.354.384 the subsidiaries net Aset pajak tangguhan -

bersih 27.720.644.748 175.860.100 888.272.678 28.784.777.526 Deferred tax assets net Liabilitas pajak

tangguhan Deferred tax liabilitiesentitas anak ( 101.035.464) - ( 1.239.314.895)( 1.340.350.359) of the subsidiaries

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/43 Exhibit E/43

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

15. ASET TETAP 15. PROPERTY, PLANT AND EQUIPMENT

31 Desember 2011 / 31 December 2011

Saldo awal/

Reklasifikasi dan

koreksi/ Akuisi Entitas

anak baru/

Saldo akhir/

Beginning balance

Penambahan / Additions

Pengurangan/ Deductions

Reclasifications and correction

Acquisition new subsidiaries

Ending balance

Biaya perolehan Acquisition CostKepemilikan Direct

langsung Ownership Tanah 208.403.048.774 30.483.555.514 - 18.922.030.088 12.247.300.000 270.055.934.376 LandBangunan dan Building and

prasarana 414.763.343.092 19.449.887.514 - 132.500.583.146 24.711.817.104 591.425.630.856 Infrastructures Mesin dan Machinery and

peralatan 448.481.251.214 24.278.802.997 - 79.598.282.829 67.066.608.506 619.424.945.546 Equipments Perlengkapan Furniture and

dan perabotan 125.699.074.838 13.269.771.291 177.514.636 ( 1.625.548.274) 10.276.875.958 147.442.659.177 Fixtures Kendaraan

bermotor 34.181.020.981 259.363.137 926.456.111 1.441.581.659 6.561.120.409 41.516.630.075 Vehicles Aset sewa Assets under

pembiayaan finance lease Kendaraan

bermotor 8.051.716.837 - - ( 1.410.473.995) - 6.641.242.842 Vehicles Aset dalam Construction in

penyelesaian Progress Tanah 1.040.022.625 - ( 1.040.022.625) - - LandMesin 10.096.735.275 55.230.091.578 - ( 35.887.406.039) - 29.439.420.814 MachineriesBangunan dan Building and

prasarana 86.609.136.126 271.282.106.850 - ( 189.017.066.575) - 168.874.176.401 infrastructures Jumlah 1.336.285.327.137 415.293.601.506 1.103.970.747 3.481.960.214 120.863.721.977 1.874.820.640.087 Total Akumulasi Accumulated

penyusutan Depreciation Kepemilikan Direct

langsung Ownership Bangunan dan Building and

prasarana 154.833.324.625 26.009.106.687 - ( 28.855.262) 6.977.867.104 187.791.443.154 Infrastructures Mesin dan Machinery and

peralatan 224.216.498.896 22.659.505.594 - 8.340.584.046 36.378.318.506 291.594.907.042 Equipment Perlengkapan Furniture and

dan perabotan 73.269.865.853 14.639.348.185 44.091.465 ( 7.449.275.468) 4.998.906.182 85.414.753.287 Fixtures Kendaraan

bermotor 26.202.124.485 3.540.485.545 643.144.472 803.262.736 2.716.376.632 32.619.104.926 Vehicles Aset sewa

pembiayaan Assets underKendaraan finance lease

bermotor 4.153.862.278 1.482.079.145 - ( 1.096.695.293) - 4.539.246.130 Vehicles Jumlah 482.675.676.137 68.330.525.156 687.235.937 569.020.759 51.071.468.424 601.959.454.539 Total Nilai Buku 853.609.651.000 1.272.861.185.548 Net Book Value

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/42 Exhibit E/42

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

14. PAJAK PENGHASILAN (Lanjutan) 14. INCOME TAX (Continued)

b. Aset (Liabilitas) Pajak Tangguhan (Lanjutan) b. Deferred Tax Assets (Liabilities) (Continued)

Dikreditkan/ (dibebankan) ke laporan laba rugi komprehensif konsolidasian/ Penyesuaian Credited(charged) penerapan to consolidated PSAK 55/ statement of Adjustment of comprehensive implementation 2 0 0 9 Income PSAK 55 2 0 1 0 Aset pajak tangguhan Deferred tax assets of the

perusahaan Company Penyisihan kerugian

penurunan nilai 35.196.824.999 ( 10.634.473.898) 1.552.140.729 26.114.491.830

Allowance for impairment losses

Aset sewa pembiayaan ( 565.984.358)( 548.446.389) - ( 1.114.430.747) LeasingPerbedaan penyusutan Difference between book

komersial dan fiskal ( 1.395.382.384)( 2.150.163.584) - ( 3.545.545.968) and tax depreciation Liabilitas Provision of employee

imbalan kerja 5.956.985.876 ( 273.434.075) - 5.683.551.801 Benefits Amortization of financialAmortisasi biaya finansial - ( 173.010.978) - ( 173.010.978) Charges Aset pajak tangguhan Deferred tax assets of the

Perusahaan-bersih 39.192.444.133 ( 13.779.528.924) 1.552.140.729 26.965.055.938 Company-net

Aset pajak tangguhan Deferred tax assets of entitas anak - bersih 749.089.932 ( 189.672.299) 196.171.177 755.588.810 the subsidiaries - net

Aset pajak tangguhan - bersih 39.941.534.065 ( 13.969.201.223) 1.748.311.906 27.720.644.748 Deferred tax assets net

Liabilitas pajak

tangguhan Deferred tax liabilitiesentitas anak ( 84.322.770)( 16.712.694) - ( 101.035.464) of the subsidiaries

c. Utang Pajak c. Taxes Payable

2 0 1 1 2 0 1 0 Pajak Penghasilan Income TaxesPerusahaan The Company

Pasal 21 971.638.389 1.281.246.935 Article 21 Pasal 23 659.195.324 971.186.283 Article 23 Pasal 26 29.660.361 25.985.450 Article 26

1.660.494.074 2.278.418.668 Entitas anak Subsidiaries

Pasal 21 6.020.166 526.249 Article 21Pasal 23 35.463.096 184.327.798 Article 23Pasal 29 Article 29

Tahun 2011 300.883.634 - Year 2011 Tahun 2010 366.047.775 366.047.775 Year 2010 Tahun 2009 442.066.383 442.066.383 Year 2009

1.150.481.054 992.968.205 Pajak Pertambahan Nilai Value Added TaxPerusahaan 205.101.268 124.745.537 The CompanyPerusahaan anak 1.272.417.015 1.714.295.844 Subsidiaries 1.477.518.283 1.839.041.381 Jumlah 4.288.493.411 5.110.428.254 T o t a l

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/43 Exhibit E/43

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

15. ASET TETAP 15. PROPERTY, PLANT AND EQUIPMENT

31 Desember 2011 / 31 December 2011

Saldo awal/

Reklasifikasi dan

koreksi/ Akuisi Entitas

anak baru/

Saldo akhir/

Beginning balance

Penambahan / Additions

Pengurangan/ Deductions

Reclasifications and correction

Acquisition new subsidiaries

Ending balance

Biaya perolehan Acquisition CostKepemilikan Direct

langsung Ownership Tanah 208.403.048.774 30.483.555.514 - 18.922.030.088 12.247.300.000 270.055.934.376 LandBangunan dan Building and

prasarana 414.763.343.092 19.449.887.514 - 132.500.583.146 24.711.817.104 591.425.630.856 Infrastructures Mesin dan Machinery and

peralatan 448.481.251.214 24.278.802.997 - 79.598.282.829 67.066.608.506 619.424.945.546 Equipments Perlengkapan Furniture and

dan perabotan 125.699.074.838 13.269.771.291 177.514.636 ( 1.625.548.274) 10.276.875.958 147.442.659.177 Fixtures Kendaraan

bermotor 34.181.020.981 259.363.137 926.456.111 1.441.581.659 6.561.120.409 41.516.630.075 Vehicles Aset sewa Assets under

pembiayaan finance lease Kendaraan

bermotor 8.051.716.837 - - ( 1.410.473.995) - 6.641.242.842 Vehicles Aset dalam Construction in

penyelesaian Progress Tanah 1.040.022.625 - ( 1.040.022.625) - - LandMesin 10.096.735.275 55.230.091.578 - ( 35.887.406.039) - 29.439.420.814 MachineriesBangunan dan Building and

prasarana 86.609.136.126 271.282.106.850 - ( 189.017.066.575) - 168.874.176.401 infrastructures Jumlah 1.336.285.327.137 415.293.601.506 1.103.970.747 3.481.960.214 120.863.721.977 1.874.820.640.087 Total Akumulasi Accumulated

penyusutan Depreciation Kepemilikan Direct

langsung Ownership Bangunan dan Building and

prasarana 154.833.324.625 26.009.106.687 - ( 28.855.262) 6.977.867.104 187.791.443.154 Infrastructures Mesin dan Machinery and

peralatan 224.216.498.896 22.659.505.594 - 8.340.584.046 36.378.318.506 291.594.907.042 Equipment Perlengkapan Furniture and

dan perabotan 73.269.865.853 14.639.348.185 44.091.465 ( 7.449.275.468) 4.998.906.182 85.414.753.287 Fixtures Kendaraan

bermotor 26.202.124.485 3.540.485.545 643.144.472 803.262.736 2.716.376.632 32.619.104.926 Vehicles Aset sewa

pembiayaan Assets underKendaraan finance lease

bermotor 4.153.862.278 1.482.079.145 - ( 1.096.695.293) - 4.539.246.130 Vehicles Jumlah 482.675.676.137 68.330.525.156 687.235.937 569.020.759 51.071.468.424 601.959.454.539 Total Nilai Buku 853.609.651.000 1.272.861.185.548 Net Book Value

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/45 Exhibit E/45

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

15. ASET TETAP (Lanjutan) 15. PROPERTY, PLANT AND EQUIPMENT (Continued)

Pengurangan aset tetap merupakan penjualan aset (2011 dan 2010) dan pengurangan yang terjadi atas kebakaran pada bahan pembibitan (Breeding Farm) 2010 dengan rincian sebagai berikut:

Disposal of property, plant, and equipment represents sale of property, plant, and equipment (2011 and 2010) and deduction due to fire occurring in Breeding Farm 2010 as follows:

2 0 1 1 2 0 1 0

Harga jual 569.479.685 1.455.801.333 Selling priceNilai buku 416.734.810 1.108.340.200 Book value Laba penjualan 152.744.875 347.461.133 Gain on sale

2 0 1 1 2 0 1 0

Penerimaan kas dari klaim asuransi - 10.040.016.024 Cash receipt from insurance claimNilai buku - 5.005.737.743 Book value Pendapatan dari klaim asuransi - 5.034.278.281 Income from insurance claim

Pada tanggal 12 Agustus 2009, Perusahaan melakukan penilaian kembali atas aset tetap tertentu dan aset tetap yang tidak digunakan sehubungan dengan kuasi-reorganisasi. Penilaian kembali dilakukan oleh perusahaan penilai independen PT Alpro Dinamika. Berdasarkan laporan dari perusahaan penilaiindependen, Perusahaan telah membukukan selisih penilaian kembali aset tetap sebesar Rp 90.666.808.072 dan aset tetap yang tidak digunakan sebesar Rp 17.713.903.577. Dalam menghitung nilai wajar, perusahaan penilai independen menggunakan pendekatan perbandingan data pasar untuk aset tanah dan untuk aset bukan tanah menggunakan metode biaya pengganti terdepresiasi.

On 12 August 2009, the Company had revaluaed itscertain property, plant and equipment and unutilizedassets for the purpose of the quasi reorganization. Revaluation was performed by independent valuer, PT Alpro Dinamika. Based on independent valuer report, the Company had recorded difference from revaluation of property, plant and equipment amounted to Rp 90,666,808,072 and unutilized assets amounted to Rp 17,713,903,577. Independent valuer company used market data comparison approach for land assets anddepreciation replacement cost method for assets other than land.

Tanah dan aset tetap lainnya yang tidak digunakan dalam operasi disajikan sebagai akun Aset Tetap yang Tidak Digunakan pada aset tidak lancar (lihat Catatan 16).

Land and other unutilized assets for operations are presented as Unutilized Assets in non-current assets (see Note 16).

Aset tetap termasuk aset tetap yang tidak digunakanmilik Grup, kecuali tanah, telah diasuransikan secara gabungan dengan persediaan Perusahaan (lihat Catatan 8) terhadap segala risiko, dengan nilai pertanggungan masing-masing pada 31 Desember 2011 dan31 Desember 2010 adalah sebagai berikut:

Property, plant and equipment including unutilized assets of the Group, except for land, are insured collectively with the Companys inventories (see Note 8) against all risk as of 31 December 2011 and 31 December 2010, respectively, with the sum insured as follows:

2 0 1 1 2 0 1 0 Rupiah USD Rupiah USD

Bangunan dan Building and prasarana 879.839.900.000 - 717.670.035.239 - infrastructures

Mesin dan peralatan 237.185.608.000 52.312.566 75.382.331.383 56.245.798 Machinery and equipmentPerlengkapan dan Furniture and

perabotan 59.461.631.472 - 53.711.238.892 - fixtures Kendaraan bermotor 14.694.800.000 - 12.201.750.000 - Vehicles

1.191.181.939.472 53.312.566 858.965.355.514 56.245.798

Manajemen berpendapat bahwa nilai pertanggungan tersebut di atas cukup memadai untuk menutupi kemungkinan kerugian atas aset yang dipertanggungkan.

Management believes that the insurance coverage is sufficient to cover any possible losses.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/44 Exhibit E/44

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

15. ASET TETAP (Lanjutan) 15. PROPERTY, PLANT AND EQUIPMENT (Continued)

31 Desember 2010 / 31 December 2010 Saldo awal/ Saldo akhir / Beginning Penambahan / Pengurangan/ Reklasifikasi/ Ending Balance Additions Deductions Reclasifications balance

Biaya perolehan Acquisition CostKepemilikan Direct

Langsung Ownership Tanah 196.647.537.686 9.791.809.855 - 1.963.701.233 208.403.048.774 LandBangunan dan Building and

prasarana 311.057.323.340 55.252.451.387 2.543.571.918 50.997.140.283 414.763.343.092 Infrastructures Mesin dan Machinery and

peralatan 403.763.554.087 23.315.349.893 6.915.114.004 28.317.461.238 448.481.251.214 Equipments Perlengkapan dan Furniture and

perabotan 81.458.608.185 39.628.708.742 1.764.766.842 6.376.524.753 125.699.074.838 Fixtures Kendaraan

bermotor 36.014.803.572 1.474.363.600 3.495.146.191 187.000.000 34.181.020.981 Vehicles Aset sewa Assets under

pembiayaan finance lease Kendaraan

bermotor 7.578.716.837 660.000.000 - ( 187.000.000) 8.051.716.837 Vehicles Aset dalam Construction in

penyelesaian Progress Mesin - 10.961.155.275 - ( 864.420.000) 10.096.735.275 MachineriesBangunan dan Building and

prasarana 54.186.647.451 119.212.896.182 - ( 86.790.407.507) 86.609.136.126 infrastructures Jumlah 1.090.707.191.158 260.296.734.934 14.718.598.955 - 1.336.285.327.137 Total Akumulasi Accumulated

penyusutan Depreciation Kepemilikan Direct

langsung Ownership Bangunan dan Building and

prasarana 141.354.553.827 14.503.719.154 1.024.948.356 - 154.833.324.625 Infrastructures Mesin dan Machinery and

peralatan 211.490.899.214 16.264.102.063 3.538.502.381 - 224.216.498.896 Equipment Perlengkapan dan Furniture and

perabotan 63.172.194.489 11.449.147.785 1.351.476.421 - 73.269.865.853 Fixtures Kendaraan

bermotor 24.660.433.534 4.044.284.805 2.689.593.854 187.000.000 26.202.124.485 Vehicles Aset sewa

pembiayaan Assets underKendaraan finance lease

bermotor 2.708.979.323 1.631.882.955 - ( 187.000.000) 4.153.862.278 Vehicles Jumlah 443.387.060.387 47.893.136.762 8.604.521.012 - 482.675.676.137 Total Nilai Buku 647.320.130.771 853.609.651.000 Net Book Value

Beban penyusutan dibebankan pada: Depreciation is charged to:

2 0 1 1 2 0 1 0 Beban produksi tidak langsung/Beban lndirect production cost/Cost of

pokok penjualan 47.089.915.977 33.503.618.466 goods sold Beban penjualan (Catatan 32) 11.055.883.485 5.457.735.471 Selling expenses (Note 32)Beban umum dan administrasi General and Administrative Expenses

(Catatan 33) 10.184.725.694 8.931.782.825 (Note 33) Jumlah 68.330.525.156 47.893.136.762 Total

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/45 Exhibit E/45

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

15. ASET TETAP (Lanjutan) 15. PROPERTY, PLANT AND EQUIPMENT (Continued)

Pengurangan aset tetap merupakan penjualan aset (2011 dan 2010) dan pengurangan yang terjadi atas kebakaran pada bahan pembibitan (Breeding Farm) 2010 dengan rincian sebagai berikut:

Disposal of property, plant, and equipment represents sale of property, plant, and equipment (2011 and 2010) and deduction due to fire occurring in Breeding Farm 2010 as follows:

2 0 1 1 2 0 1 0

Harga jual 569.479.685 1.455.801.333 Selling priceNilai buku 416.734.810 1.108.340.200 Book value Laba penjualan 152.744.875 347.461.133 Gain on sale

2 0 1 1 2 0 1 0

Penerimaan kas dari klaim asuransi - 10.040.016.024 Cash receipt from insurance claimNilai buku - 5.005.737.743 Book value Pendapatan dari klaim asuransi - 5.034.278.281 Income from insurance claim

Pada tanggal 12 Agustus 2009, Perusahaan melakukan penilaian kembali atas aset tetap tertentu dan aset tetap yang tidak digunakan sehubungan dengan kuasi-reorganisasi. Penilaian kembali dilakukan oleh perusahaan penilai independen PT Alpro Dinamika. Berdasarkan laporan dari perusahaan penilaiindependen, Perusahaan telah membukukan selisih penilaian kembali aset tetap sebesar Rp 90.666.808.072 dan aset tetap yang tidak digunakan sebesar Rp 17.713.903.577. Dalam menghitung nilai wajar, perusahaan penilai independen menggunakan pendekatan perbandingan data pasar untuk aset tanah dan untuk aset bukan tanah menggunakan metode biaya pengganti terdepresiasi.

On 12 August 2009, the Company had revaluaed itscertain property, plant and equipment and unutilizedassets for the purpose of the quasi reorganization. Revaluation was performed by independent valuer, PT Alpro Dinamika. Based on independent valuer report, the Company had recorded difference from revaluation of property, plant and equipment amounted to Rp 90,666,808,072 and unutilized assets amounted to Rp 17,713,903,577. Independent valuer company used market data comparison approach for land assets anddepreciation replacement cost method for assets other than land.

Tanah dan aset tetap lainnya yang tidak digunakan dalam operasi disajikan sebagai akun Aset Tetap yang Tidak Digunakan pada aset tidak lancar (lihat Catatan 16).

Land and other unutilized assets for operations are presented as Unutilized Assets in non-current assets (see Note 16).

Aset tetap termasuk aset tetap yang tidak digunakanmilik Grup, kecuali tanah, telah diasuransikan secara gabungan dengan persediaan Perusahaan (lihat Catatan 8) terhadap segala risiko, dengan nilai pertanggungan masing-masing pada 31 Desember 2011 dan31 Desember 2010 adalah sebagai berikut:

Property, plant and equipment including unutilized assets of the Group, except for land, are insured collectively with the Companys inventories (see Note 8) against all risk as of 31 December 2011 and 31 December 2010, respectively, with the sum insured as follows:

2 0 1 1 2 0 1 0 Rupiah USD Rupiah USD

Bangunan dan Building and prasarana 879.839.900.000 - 717.670.035.239 - infrastructures

Mesin dan peralatan 237.185.608.000 52.312.566 75.382.331.383 56.245.798 Machinery and equipmentPerlengkapan dan Furniture and

perabotan 59.461.631.472 - 53.711.238.892 - fixtures Kendaraan bermotor 14.694.800.000 - 12.201.750.000 - Vehicles

1.191.181.939.472 53.312.566 858.965.355.514 56.245.798

Manajemen berpendapat bahwa nilai pertanggungan tersebut di atas cukup memadai untuk menutupi kemungkinan kerugian atas aset yang dipertanggungkan.

Management believes that the insurance coverage is sufficient to cover any possible losses.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/47 Exhibit E/47

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

16. ASET TETAP YANG TIDAK DIGUNAKAN 16. UNUTILIZED ASSETS

2 0 1 1 2 0 1 0

Perusahaan The CompanyNilai tercatat Carrying value

Tanah dan bangunan - 853.080.000 Land and building Mesin dan peralatan pabrik - 3.163.648.908 Machineries and equipments Peralatan kantor - 988.797 Furniture and fixtures

Sub jumlah - 4.017.717.705 Sub total Entitas anak SubsidiaryPT Sierad Corporation 4.780.847.749 4.780.847.749 PT Sierad Corporation Jumlah 4.780.847.749 8.798.565.454 T o t a l

Beban penyusutan atas Aset Tetap Yang Tidak Digunakan telah dibebankan masing-masing sebesar Rp 1.352.258.470 dan Rp 1.401.242.892 pada laporan laba rugi komprensif konsolidasian tahun 2011 dan 2010.

The depreciation expense of Unutilized Assets had been charged amounted to Rp 1,352,258,470 and Rp 1,401,242,892 in consolidated statement of comprehensive income for the year 2011 and 2010 respectively.

Pada 30 Juni 2009, Perusahaan telah membukukan selisih penilaian kembali aset tetap yang tidak digunakan sebesar Rp 17.713.903.577 (lihat Catatan 41).

As of 30 June 2009, the Company had recognized differences from revaluation of unutilized assets amounted to Rp 17,713,903,577 (see Note 41).

Aset tetap yang tidak digunakan milik Grup, kecuali tanah, telah diasuransikan secara gabungan dengan aset tetap Perusahaan terhadap segala risiko (lihat Catatan 15).

Unutilized assets of Group, excluding land, are insured collectively with the Companys property, plant, and equipment against all risks (see Note 15).

Aset tetap yang tidak digunakan milik Perusahaan terletak di Desa Jabon Bogor, Lampung dan Mojokerto, sementara aset tetap yang tidak digunakan milik entitas anak adalah berupa tanah yang terletak di Pontianak, Kalimantan Barat.

Unutilized assets owned by the Company are located in Jabon Village, Bogor, Lampung and Mojokerto, meanwhile, unutilized assets owned by the subsidiaries in form of land are located in Pontianak, West Kalimantan.

Aset-aset tetap yang tidak digunakan tersebut direncanakan untuk dimanfaatkan dimasa yang akan datang.

The unutilized assets will be used in the future.

17. TAGIHAN PAJAK PENGHASILAN 17. CLAIMS FOR TAX REFUND

2 0 1 1 2 0 1 0 Pajak Penghasilan Income Tax Perusahaan The Company Pasal 28 - 2011 12.864.720.490 - Article 28 2011 Pasal 28 - 2010 5.930.387.769 - Article 28 2010 Pasal 28 A - 2009 4.823.649.648 4.823.649.648 Article 28 A 2009 Entitas anak Subsidiaries Pasal 22 603.486.064 - Article 22 Pasal 25 24.146.692 - Article 25 Pasal 28-A 48.293.384 - Article 28-A Jumlah 24.294.684.047 4.823.649.648 Total

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/46 Exhibit E/46

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

15. ASET TETAP (Lanjutan) 15. PROPERTY, PLANT AND EQUIPMENT (Continued)

Beberapa bidang tanah dan bangunan milik Perusahaan dijadikan jaminan atas pinjaman yang diperoleh dari Bank (lihat Catatan 22, 23 dan 24).

Several lots of land and building owned by the Company are secured for loan obtained from Banks (see Notes 22, 23 and 24).

Rincian aset dalam penyelesaian pada tahun 2011 dan 2010 adalah sebagai berikut :

The detail of contruction in progress in 2011 and 2010 are as follows :

2 0 1 1 Perkiraan %

Penyelesaian/ Estimated % of

Completion

Jumlah Tercatat/ Carrying Amount

Tahun Perkiraan Penyelesaian/

Estimated Year of Completion

Bangunan dan prasarana 3% - 98% 168.874.176.401 2012 Building and infrastructuresMesin dan peralatan 1% - 95% 29.439.420.814 2012 Machinery and equipment

198.313.597.215

2 0 1 0 Perkiraan %

Penyelesaian/ Estimated % of

Completion

Jumlah Tercatat/ Carrying Amount

Tahun Perkiraan Penyelesaian/

Estimated Year of Completion

Bangunan dan prasarana 52% - 85% 86.609.136.126 2011 - 2012 Building and infrastructuresMesin dan peralatan 80% 10.096.735.275 2012 Machinery and equipment

96.705.871.401

Aset dalam penyelesaian terutama merupakan pembangunan Office Space pada The City Tower 1 lantai7, Jl KH Mas Mansyur, Jakarta. Pada 31 Desember 2010, pembangunan Office Space telah mencapai 52% dan diperkirakan akan serah terima dari Developer pada bulan Desember 2012 dan proyek pembangunan kandang yang terletak di Desa Lebak Asih, Kecamatan Curuk Bitung dan Desa Sukarame, Kecamatan Sajira, Kabupaten Lebak, Propinsi Banten.

Construction in progress mainly represents construction of Office Space in The City Tower 1, 7th floor, Jl KH Mas Mansyur, Jakarta. As of 31 December 2010, the construction of Office Space has reached 52% and is expected to handover from the developers of December 2012 and Farm development project located in Lebak Asih village, Curuk Bitung district and Sukarame Village, Sajira District, Lebak Regency, Banten Province.

Pada bulan Oktober 2011, beberapa Aset Tetap Yang Tidak Digunakan telah digunakan kembali oleh Perusahaan, sehingga aset tetap yang tidak digunakandengan nilai perolehan sebesar Rp 3.400.207.580 dan akumulasi penyusutan sebesar Rp 734.748.340 telah direklasifikasikan ke dalam aset tetap.

In October 2011, several lots of unutilized assets had been utilized by the Company, therefore the total cost of unutilized assets amounted to Rp 3,400,207,580 and accumulated depreciation of Rp 734,748,340 were reclassified into property, plant and equipment.

Manajemen berpendapat bahwa tidak terdapat penurunan nilai atas nilai tercatat aset tetap.

Management believes that there is no indication of impairment upon the Companys property, plant andequipment carrying value.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/47 Exhibit E/47

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

16. ASET TETAP YANG TIDAK DIGUNAKAN 16. UNUTILIZED ASSETS

2 0 1 1 2 0 1 0

Perusahaan The CompanyNilai tercatat Carrying value

Tanah dan bangunan - 853.080.000 Land and building Mesin dan peralatan pabrik - 3.163.648.908 Machineries and equipments Peralatan kantor - 988.797 Furniture and fixtures

Sub jumlah - 4.017.717.705 Sub total Entitas anak SubsidiaryPT Sierad Corporation 4.780.847.749 4.780.847.749 PT Sierad Corporation Jumlah 4.780.847.749 8.798.565.454 T o t a l

Beban penyusutan atas Aset Tetap Yang Tidak Digunakan telah dibebankan masing-masing sebesar Rp 1.352.258.470 dan Rp 1.401.242.892 pada laporan laba rugi komprensif konsolidasian tahun 2011 dan 2010.

The depreciation expense of Unutilized Assets had been charged amounted to Rp 1,352,258,470 and Rp 1,401,242,892 in consolidated statement of comprehensive income for the year 2011 and 2010 respectively.

Pada 30 Juni 2009, Perusahaan telah membukukan selisih penilaian kembali aset tetap yang tidak digunakan sebesar Rp 17.713.903.577 (lihat Catatan 41).

As of 30 June 2009, the Company had recognized differences from revaluation of unutilized assets amounted to Rp 17,713,903,577 (see Note 41).

Aset tetap yang tidak digunakan milik Grup, kecuali tanah, telah diasuransikan secara gabungan dengan aset tetap Perusahaan terhadap segala risiko (lihat Catatan 15).

Unutilized assets of Group, excluding land, are insured collectively with the Companys property, plant, and equipment against all risks (see Note 15).

Aset tetap yang tidak digunakan milik Perusahaan terletak di Desa Jabon Bogor, Lampung dan Mojokerto, sementara aset tetap yang tidak digunakan milik entitas anak adalah berupa tanah yang terletak di Pontianak, Kalimantan Barat.

Unutilized assets owned by the Company are located in Jabon Village, Bogor, Lampung and Mojokerto, meanwhile, unutilized assets owned by the subsidiaries in form of land are located in Pontianak, West Kalimantan.

Aset-aset tetap yang tidak digunakan tersebut direncanakan untuk dimanfaatkan dimasa yang akan datang.

The unutilized assets will be used in the future.

17. TAGIHAN PAJAK PENGHASILAN 17. CLAIMS FOR TAX REFUND

2 0 1 1 2 0 1 0 Pajak Penghasilan Income Tax Perusahaan The Company Pasal 28 - 2011 12.864.720.490 - Article 28 2011 Pasal 28 - 2010 5.930.387.769 - Article 28 2010 Pasal 28 A - 2009 4.823.649.648 4.823.649.648 Article 28 A 2009 Entitas anak Subsidiaries Pasal 22 603.486.064 - Article 22 Pasal 25 24.146.692 - Article 25 Pasal 28-A 48.293.384 - Article 28-A Jumlah 24.294.684.047 4.823.649.648 Total

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/49 Exhibit E/49

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

19. ASET TIDAK BERWUJUD 19. INTANGIBLE ASSETS

Saldo awal/ Beginning balance

Akuisi Entitas anak baru/

Acquisition of new

subsidiaries

Penambahan/ Addition

Pengurangan/ Deduction

Saldo akhir/ Ending balance

Biaya perolehan C o s t Merek - 23.737.048.623 - - 23.737.048.623 BrandHubungan dengan

Konsumen - 11.135.625.335 - - 11.135.625.335 Customer relationshipHak paten - 161.200.000 324.750.000 - 485.950.000 Patent Jumlah biaya

perolehan - 35.033.873.958 324.750.000

- 35.358.623.958 Total cost

Akumulasi amortisasi

Accumulated amortization

Merek - - ( 263.744.985) - ( 263.744.985) BrandHubungan dengan

Konsumen - - ( 371.187.511) - ( 371.187.511) Customer relationshipHak paten - - - - - PatentJumlah akumulasi

amortisasi - - ( 634.932.496 ) - ( 634.932.496)

Total accumulatedamortization

Nilai tercatat - 34.723.691.462 Carrying amount

20. UTANG USAHA PIHAK KETIGA 20. TRADE PAYABLES THIRD PARTIES

Akun ini merupakan liabilitas yang timbul atas pembelian bahan baku dan bahan pembantu, dengan rincian sebagai berikut:

This account represents payables due to the purchase of raw materials and supporting materials, with the detail as follows:

2 0 1 1 2 0 1 0

Pihak ketiga Third partiesRupiah 110.192.291.610 70.033.144.475 RupiahUS Dolar 92.768.263.591 49.724.957.727 US DollarSwiss Franc 16.314.078 - Swiss FrancSingapore Dolar - 65.658.570 Singapore Dollar Jumlah 202.976.869.279 119.823.760.772 T o t a l

21. BEBAN YANG MASIH HARUS DIBAYAR 21. ACCRUED EXPENSES

2 0 1 1 2 0 1 0

Taksiran liabilitas sehubungan Estimated liability under dengan Stock Financing Agreement Stock Financing Agreement(lihat Catatan 37b) 7.779.125.037 11.671.343.398 (see Note 37b)

Listrik, air dan telepon 3.414.726.634 1.758.735.622 Electricity , water and telephoneBunga 1.917.403.355 750.689.571 InterestOngkos angkut 1.690.467.278 5.904.411.650 Freight and deliveryS e w a 1.136.646.827 11.388.453.860 RentalJasa professional 1.007.193.750 848.386.783 Professional feeGaji dan tunjangan 609.227.673 225.317.176 Salaries and benefitsAsuransi dan jamsostek 591.335.367 313.978.536 Insurance and social security benefitIklan dan promosi 358.031.756 37.500.000 Advertisement and promotionLainnya 7.281.915.390 5.996.847.661 Others Jumlah 25.786.073.067 38.895.664.257 T o t a l

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/48 Exhibit E/48

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

17. TAGIHAN PAJAK PENGHASILAN (Lanjutan) 17. CLAIMS FOR TAX REFUND (Continued)

Pada tanggal 30 September 2011, Perusahaan menerima Surat Ketetapan Pajak Lebih Bayar (SKPLB) No. 00145/406/09/054/11 dari Kantor Pelayanan Pajak Perusahaan Masuk Bursa (KPP PMB) untuk jenis pajak penghasilan badan tahun 2009sebesar Rp 1.504.759.303 dan pada tanggal16 Nopember 2011, Perusahaan telah menerima pengembalian pajak tersebut sebesar Rp 820.711.058 (jumlah setelah dikurangi utang pajak Rp 684.048.245). Pada tanggal 15 Desember 2011, Perusahaan telah mengajukan surat keberatan No. 121/TAX/SP/XII/11 terhadap Surat Ketetapan Pajak Lebih Bayar (SKPLB) tersebut. Berdasarkan Pemberitahuan Surat Keberatan No. S-368/WPJ.07/KP.0803/2011 tanggal 21 Desember 2011 dari Kantor Pelayanan Pajak Perusahaan Masuk Bursa, surat keberatan masih dalam proses Kantor Pelayanan Pajak Perusahaan Masuk Bursa (KPP PMB).

On 30 September 2011, the Company received Overpayment Tax Assessment Notice (SKPLB) No. 00145/406/09/054/11 from Tax Office for Listed Companies (KPP PMB) for corporate income tax year 2009 amounted to Rp 1,504,759,303 and on 16 November 2011, the Company received tax refund for overpayment tax amounted to Rp 820,711,058 (after deducted by taxes payable at amount of Rp 684,048,245). On 15 Desember 2011, the Company filed a letter of objection No. 121/TA/SP/XII/11 of the Overpayment Tax Assessment Notice (SKPLB). Based on the Notice of Objection Letter no. S-368/WPJ.07/KP.0803/2011 dated 21 December 2011 from Tax Office for Listed Companies (KPP PMB), the letter of objecton is under review of Tax Office for Listed Companies (KPP PMB).

Pada tanggal 4 Juni 2010, Perusahaan menerima Surat Ketetapan Pajak Lebih Bayar (SKPLB) dari Kantor Pelayanan Pajak Perusahaan Masuk Bursa (KPP PMB) untuk jenis pajak penghasilan badantahun 2008 sebesar Rp 6.029.065.212 dan pada tanggal 8 Juli 2010, Perusahaan telah menerima pengembalian pajak tersebut sebesar Rp 5.669.511.083 (jumlah setelah dikurangi utang pajak Rp 359.554.129).

On 4 June 2010, the Company received Overpayment Tax Assessment Notice (SKPLB) from Tax Office for Listed Companies (KPP PMB) for corporate income tax year 2008 amounted to Rp 6,029,065,212 and on 8 July 2010, the Company received tax refund for overpayment tax amounted to Rp 5,669,511,083 (after deducted by taxes payable at amount of Rp 359,554,129).

18. GOODWILL 18. GOODWILL

Berdasarkan keputusan Rapat Umum Pemegang Saham Luar Biasa Perusahaan pada tanggal 30 Juni 2009, yang telah dituangkan dalam akta berita acara nomor 188, telah disetujui pengambilalihan (akuisisi) saham dalam PT Belfoods Indonesia (BI) sebanyak 596.806 saham dengan harga saham Rp 100.000 per saham dengan cara konversi utang menjadi kepemilikan saham (debt to equity swap). Kepemilikan saham tersebut berasal dari utangPT Belfoods Indonesia sebanyak Rp 59.680.578.837 kepada Grup dan dari akuisisi tersebut menghasilkan goodwill sebesar Rp 10.890.455.260 (lihat Catatan 4).

Based on deeds of Company's Extraordinary General Meeting of Shareholders decision No. 188 dated 30 June 2009, it was approved the acquisition of share in PT Belfoods Indonesia (BI) of 596.806 shares with share price of Rp 100,000 each, by converting debt into shares (debt to equity swap). The ownership of these shares is from the debt ofPT Belfood Indonesia amounting to Rp 59,680,578,837 to Group and the acquisition has resulted in goodwill amounting to Rp 10,890,455,260 (see Note 4).

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/49 Exhibit E/49

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

19. ASET TIDAK BERWUJUD 19. INTANGIBLE ASSETS

Saldo awal/ Beginning balance

Akuisi Entitas anak baru/

Acquisition of new

subsidiaries

Penambahan/ Addition

Pengurangan/ Deduction

Saldo akhir/ Ending balance

Biaya perolehan C o s t Merek - 23.737.048.623 - - 23.737.048.623 BrandHubungan dengan

Konsumen - 11.135.625.335 - - 11.135.625.335 Customer relationshipHak paten - 161.200.000 324.750.000 - 485.950.000 Patent Jumlah biaya

perolehan - 35.033.873.958 324.750.000

- 35.358.623.958 Total cost

Akumulasi amortisasi

Accumulated amortization

Merek - - ( 263.744.985) - ( 263.744.985) BrandHubungan dengan

Konsumen - - ( 371.187.511) - ( 371.187.511) Customer relationshipHak paten - - - - - PatentJumlah akumulasi

amortisasi - - ( 634.932.496 ) - ( 634.932.496)

Total accumulatedamortization

Nilai tercatat - 34.723.691.462 Carrying amount

20. UTANG USAHA PIHAK KETIGA 20. TRADE PAYABLES THIRD PARTIES

Akun ini merupakan liabilitas yang timbul atas pembelian bahan baku dan bahan pembantu, dengan rincian sebagai berikut:

This account represents payables due to the purchase of raw materials and supporting materials, with the detail as follows:

2 0 1 1 2 0 1 0

Pihak ketiga Third partiesRupiah 110.192.291.610 70.033.144.475 RupiahUS Dolar 92.768.263.591 49.724.957.727 US DollarSwiss Franc 16.314.078 - Swiss FrancSingapore Dolar - 65.658.570 Singapore Dollar Jumlah 202.976.869.279 119.823.760.772 T o t a l

21. BEBAN YANG MASIH HARUS DIBAYAR 21. ACCRUED EXPENSES

2 0 1 1 2 0 1 0

Taksiran liabilitas sehubungan Estimated liability under dengan Stock Financing Agreement Stock Financing Agreement(lihat Catatan 37b) 7.779.125.037 11.671.343.398 (see Note 37b)

Listrik, air dan telepon 3.414.726.634 1.758.735.622 Electricity , water and telephoneBunga 1.917.403.355 750.689.571 InterestOngkos angkut 1.690.467.278 5.904.411.650 Freight and deliveryS e w a 1.136.646.827 11.388.453.860 RentalJasa professional 1.007.193.750 848.386.783 Professional feeGaji dan tunjangan 609.227.673 225.317.176 Salaries and benefitsAsuransi dan jamsostek 591.335.367 313.978.536 Insurance and social security benefitIklan dan promosi 358.031.756 37.500.000 Advertisement and promotionLainnya 7.281.915.390 5.996.847.661 Others Jumlah 25.786.073.067 38.895.664.257 T o t a l

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/51 Exhibit E/51

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

22. UTANG BANK JANGKA PENDEK (Lanjutan) 22. SHORT-TERM BANK LOANS (Continued)

a. PT Bank Negara Indonesia (Persero) Tbk (Lanjutan) a. PT Bank Negara Indonesia (Persero)Tbk (Continued)

Fasilitas pinjaman yang diperoleh dari BNI dijamin dengan jaminan:

Credit facility that obtained from BNI was secured by:

3 (tiga) bidang tanah yang terletak di Desa

Ploso, Kecamatan Wonoayu, Kabupaten Sidoarjo, Propinsi Jawa Timur dengan Sertifikat Hak Guna Bangunan (SHGB) No. 1 seluas 35.741 m2 , SHGB No. 2 seluas 110.734 m2 dan SHGB No. 3 seluas 53.525 m2 yang terdaftar atas nama Perusahaan (lihat Catatan 15);

3 (three) land lot which are located in Ploso Village, Wonoayu District, Sidoarjo Regency, East Java Province under Building Rights Title Certificate (SHGB) No.1 with 35,741 sqm, Building Rights Title Certificate (SHGB) No. 2 with 110,734 sqm, and Building Rights Title (SHGB) No. 3 with 53,525 sqm. All of these are registered under the name ofCompany (see Note 15);

2 (dua) bidang tanah di Desa Ketimang,

Kecamatan Wonoayu, Kabupaten Sidoarjo, Propinsi Jawa Timur dengan Sertifikat Hak Guna Bangunan (SHGB) No. 2 seluas 57.863m2 dan SHGB No. 1 seluas 21.812 m2 yang terdaftar atas nama Perusahaan (lihatCatatan 15);

2 (two) land lot in Ketimang Village, Wonoayu District, Sidoarjo Regency, East Java Province under Building Rights Title Certificate (SHGB) No. 2 with 57,863 sqmand Building Rights Title Certificate (SHGB) No. 1 with 21,812 sqm which are registered under the name of the Company (see Note 15);

Kelima tanah diatas berikut bangunan yang berdiri di atas tanah tersebut diikat dengan Hak Tanggungan Peringkat I sebesar Rp 149 milyar.

The five of the land lot above and buildings there on are included under contract of First Class Mortgage (Hak Tanggungan Peringkat) amounted to Rp 149 billion.

Bangunan dan mesin-mesin pakan ternak

beserta sebidang tanah yang terletak di Desa Gembong, Kecamatan Balaraja, Kabupaten Tangerang, Propinsi Jawa Barat dengan Sertifikat Hak Guna Bangunan (SHGB) No. 2 seluas 625 m2 yang terdaftar atas namaPerusahaan (lihat Catatan 15) dan diikat dengan Hak Tanggungan Peringkat I sebesar Rp 700 juta;

Building, feedmill machineries and a land lotwhich are located in Gembong Village, Balaraja District, Tangerang Regency, West Java Province under Building Rights Title Certificates (SHGB) No. 2 with 625 sqm that are registered under the name of the Company (see Note 15) and under contract of First Class Mortgage amounted to Rp 700 million;

3 (tiga) bidang tanah beserta bangunan dan

mesin-mesin pakan ternak yang terletak di Desa Cangkudu, Kecamatan Balaraja, Kabupaten Tangerang, Propinsi Jawa Barat dengan Sertifikat Hak Guna Bangunan (SHGB) No. 1 seluas 46.215 m2, No. 2 seluas 1.200 m2 dan No. 3 seluas 905 m2 yang terdaftar atas nama Perusahaan (lihat Catatan 15); dan diikat Hak Tanggungan Peringkat I sebesar Rp 55 milyar.

3 (three) land lot with building and feedmill machine which are located in Cangkudu Village, Balaraja District, Tangerang Regency, West Java Province under Building Rights Title Certificates (SHGB) No.1 with 46.215 sqm, No.2 with 1,200 sqm and No. 3 with 905 sqm which are registered under the name of the Company (see Note 15); and under contract of First Class Mortgage amounted to Rp 55 billion.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/50 Exhibit E/50

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

22. UTANG BANK JANGKA PENDEK 22. SHORT-TERM BANK LOANS

2 0 1 1 2 0 1 0 Fasilitas kredit modal kerja : Working capital credit facilities :PT Bank Negara Indonesia PT Bank Negara Indonesia

(Persero) Tbk (a) 278.158.585.865 214.987.874.030 (Persero) Tbk (a) PT Bank Mandiri (Persero) Tbk (b) 150.000.000.000 25.000.000.000 PT Bank Mandiri (Persero) Tbk (b)PT Bank Rakyat Indonesia PT Bank Rakyat Indonesia

(Persero) Tbk (c) - 39.972.779.019 (Persero) Tbk (c) Fasilitas pembiayaan niaga tidak

terikat :

Uncommitted trade finance facilities :Raiffeisen Bank International (d) - 42.746.033.757 Raiffeisen Bank International (d)

428.158.585.865 322.706.686.806

Biaya transaksi yang belum diamortisasi ( 3.696.760.105 ) ( 2.231.386.407) Unamortized transaction costs

424.461.825.760 320.475.300.399

a. PT Bank Negara Indonesia (Persero) Tbk a. PT Bank Negara Indonesia (Persero)Tbk

i. Berdasarkan Perjanjian Kredit No. 32 dan No. 33 tanggal 25 September 2007 yang dinyatakan dalam akta Notaris Dr. Irawan Soerodjo, SH, MSi, Notaris di Jakarta, Perusahaan memperoleh pinjaman dari PT Bank Negara Indonesia (Persero) Tbk (BNI)berupa pinjaman kredit modal kerja dengan jumlah maksimum sebesar Rp 225.000.000.000 yang terdiri dari Rp 200.000.000.000 digunakan untuk meningkatkan kapasitas produksi pakan dan Rp 25.000.000.000 digunakan untuk meningkatkan kapasitas populasi hasil produksi mitra.

i. Based on Letter of Credit Agreement No. 32 and 33 dated 25 September 2007 made before Dr. lrawan Soerodjo, SH, MSi, a Notary in Jakarta, the Company obtained working capital loan from PT Bank Negara Indonesia (Persero) Tbk (BNI) with maximum limit of Rp 225,000,000,000 which consist of Rp 200,000,000,000 used to increase feeds production capacity and of Rp 25,000,000,000 used to expand population capacity of production from partnership.

Perjanjian ini telah diubah beberapa kali, terakhir dengan perubahan perjanjian kredit tanggal 15 Juni 2011 yang memuat perubahan atas tujuan fasilitas pinjaman, yaitu menjadi tambahan modal kerja untuk industri pakan ternak dan peternakan ayam. Pada tanggal 31 Desember 2011 saldo pinjaman kredit modal kerja fasilitas maksimum Rp 225.000.000.000 adalah sebesar Rp 202.195.095.839 (2010: Rp 139.006.749.592).

This agreement has been amended for several times and the last amendment was 15 June 2011which contains amendments to the loan facility purpose, is to additional working capital for the animal feed industry and poultry. As of31 December 2011, outstanding balance of working capital loan maximum facilityRp 225,000,000,000 is amounted toRp 202,195,095,839 (2010:Rp 139,006,749,592).

Pinjaman ini dikenakan suku bunga sebesar 10% per tahun (floating rate) dan akan jatuh tempo pada tanggal 15 Juni 2012 dan dapat diperpanjang kembali sesuai dengan kesepakatan kedua belah pihak.

This loan bears a floating interest rate of 10% annually. The loan will mature on 15 Juni 2012 and might be extended based on consensus of both parties

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/51 Exhibit E/51

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

22. UTANG BANK JANGKA PENDEK (Lanjutan) 22. SHORT-TERM BANK LOANS (Continued)

a. PT Bank Negara Indonesia (Persero) Tbk (Lanjutan) a. PT Bank Negara Indonesia (Persero)Tbk (Continued)

Fasilitas pinjaman yang diperoleh dari BNI dijamin dengan jaminan:

Credit facility that obtained from BNI was secured by:

3 (tiga) bidang tanah yang terletak di Desa

Ploso, Kecamatan Wonoayu, Kabupaten Sidoarjo, Propinsi Jawa Timur dengan Sertifikat Hak Guna Bangunan (SHGB) No. 1 seluas 35.741 m2 , SHGB No. 2 seluas 110.734 m2 dan SHGB No. 3 seluas 53.525 m2 yang terdaftar atas nama Perusahaan (lihat Catatan 15);

3 (three) land lot which are located in Ploso Village, Wonoayu District, Sidoarjo Regency, East Java Province under Building Rights Title Certificate (SHGB) No.1 with 35,741 sqm, Building Rights Title Certificate (SHGB) No. 2 with 110,734 sqm, and Building Rights Title (SHGB) No. 3 with 53,525 sqm. All of these are registered under the name ofCompany (see Note 15);

2 (dua) bidang tanah di Desa Ketimang,

Kecamatan Wonoayu, Kabupaten Sidoarjo, Propinsi Jawa Timur dengan Sertifikat Hak Guna Bangunan (SHGB) No. 2 seluas 57.863m2 dan SHGB No. 1 seluas 21.812 m2 yang terdaftar atas nama Perusahaan (lihatCatatan 15);

2 (two) land lot in Ketimang Village, Wonoayu District, Sidoarjo Regency, East Java Province under Building Rights Title Certificate (SHGB) No. 2 with 57,863 sqmand Building Rights Title Certificate (SHGB) No. 1 with 21,812 sqm which are registered under the name of the Company (see Note 15);

Kelima tanah diatas berikut bangunan yang berdiri di atas tanah tersebut diikat dengan Hak Tanggungan Peringkat I sebesar Rp 149 milyar.

The five of the land lot above and buildings there on are included under contract of First Class Mortgage (Hak Tanggungan Peringkat) amounted to Rp 149 billion.

Bangunan dan mesin-mesin pakan ternak

beserta sebidang tanah yang terletak di Desa Gembong, Kecamatan Balaraja, Kabupaten Tangerang, Propinsi Jawa Barat dengan Sertifikat Hak Guna Bangunan (SHGB) No. 2 seluas 625 m2 yang terdaftar atas namaPerusahaan (lihat Catatan 15) dan diikat dengan Hak Tanggungan Peringkat I sebesar Rp 700 juta;

Building, feedmill machineries and a land lotwhich are located in Gembong Village, Balaraja District, Tangerang Regency, West Java Province under Building Rights Title Certificates (SHGB) No. 2 with 625 sqm that are registered under the name of the Company (see Note 15) and under contract of First Class Mortgage amounted to Rp 700 million;

3 (tiga) bidang tanah beserta bangunan dan

mesin-mesin pakan ternak yang terletak di Desa Cangkudu, Kecamatan Balaraja, Kabupaten Tangerang, Propinsi Jawa Barat dengan Sertifikat Hak Guna Bangunan (SHGB) No. 1 seluas 46.215 m2, No. 2 seluas 1.200 m2 dan No. 3 seluas 905 m2 yang terdaftar atas nama Perusahaan (lihat Catatan 15); dan diikat Hak Tanggungan Peringkat I sebesar Rp 55 milyar.

3 (three) land lot with building and feedmill machine which are located in Cangkudu Village, Balaraja District, Tangerang Regency, West Java Province under Building Rights Title Certificates (SHGB) No.1 with 46.215 sqm, No.2 with 1,200 sqm and No. 3 with 905 sqm which are registered under the name of the Company (see Note 15); and under contract of First Class Mortgage amounted to Rp 55 billion.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/53 Exhibit E/53

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

22. UTANG BANK JANGKA PENDEK (Lanjutan) 22. SHORT-TERM BANK LOANS (Continued)

a. PT Bank Negara Indonesia (Persero) Tbk (Lanjutan)

a. PT Bank Negara Indonesia (Persero) Tbk (Continued)

ii. Berdasarkan Perjanjian Kredit No. 87 tanggal

16 Juni 2009 yang dinyatakan dalam akta Notaris Dr. Irawan Soerodjo, SH, MSi, Notaris di Jakarta, Perusahaan memperoleh tambahan fasilitas kredit dari BNI berupa kredit modal kerja maksimum sebesar Rp 75.000.000.000 untuk keperluan meningkatkan kapasitas produksi pakan ternak minimal 650.000 ton per tahun. Perjanjian ini mengalami perubahan beberapa kali dan terakhir pada tanggal 15 Juni 2011 yang memuat perubahan atas tujuan fasilitas pinjaman, yaitu menjadi tambahan modal kerja untuk industri pakan ternak dan peternakan ayam. Pada tanggal 31 Desember 2011 , saldo pinjaman kredit modal kerja fasilitas maksimum Rp 75.000.000.000 adalah sebesar Rp 74.773.559.550 (2010: Rp 74.616.153.703).

ii. Based on Credit Agreement No. 87 dated 16 June 2009 made before Dr. lrawan Soerodjo, SH, MSi, a Notary in Jakarta, the Company had obtained additional credit facility, working capital loan with maximum credit limit amounted to Rp 75,000,000,000 for the purpose of increasing capacity production of feedmill to a minimum of 650,000 ton per year. This agreement has been amanded for several times and the last amendment on 15 Juni 2011 which contains amendments to the loan facility purpose, is to additional working capital for the animal feed industry and poultry. As of 31 December 2011, outstanding balance of working capital loan maximum facility Rp 75,000,000,000 amounted toRp 74,773,559,550 (2010: Rp 74,616,153,703).

Pinjaman ini dikenakan suku bunga sebesar 10% per tahun (floating rate) dan akan jatuh tempo pada tanggal 15 Juni 2012 dan dapat diperpanjang kembali sesuai dengan kesepakatan kedua belah pihak.

This loan bears a floating interest rate of 10% annually. The loan will mature on 15 June 2012 and might be extended based on consensus of both parties

Jaminan atas fasilitas ini terikat secara Cross Collateralized terhadap fasilitas kredit modal kerja dengan Perjanjian Kredit No. 32 dan No. 33 yang diperoleh Perusahaan dari BNI.

The collateral for this facility was "Cross Collateralized" against working capital loan facility under Letter of Agreement No. 32 and No. 33 obtained from BNI.

Atas pinjaman ini, Perusahaan terikat dengan pembatasan tidak diperkenankan sama dengan yang ditetapkan pada fasilitas kredit modal kerja dengan Perjanjian No. 32 dan 33.

Under this agreement, the Company is bound to several covenants which are corresponding to the working capital loan facility under Letter of Agreements No. 32 and No. 33.

b. PT Bank Mandiri (Persero) Tbk b. PT Bank Mandiri (Persero) Tbk

i. Berdasarkan Perjanjian Kredit No. 198 tanggal

28 September 2010, yang dinyatakan dalam akta Notaris Dr. Irawan Soerodjo, SH, MSi, Notaris di Jakarta, Perusahaan memperoleh pinjaman dari PT Bank Mandiri (Persero) Tbk (Bank Mandiri) berupa fasilitas kredit modal kerja dengan jumlah maksimum sebesar Rp 25.000.000.000 yang digunakan untuk modal kerja peternakan ayam terpadu. Fasilitas ini diperpanjang hingga 27 September 2012 dengan suku bunga sebesar 10,5 % per tahun.

i. Based on Letter of Credit Agreement No. 198 dated 28 September 2010 made before Irawan Soerodjo SH, MSi, a Notary in Jakarta, the Company obtained working capital loan from PT Bank Mandiri (Persero) Tbk (Bank Mandiri) with maximum limit of Rp 25,000,000,000 whichused to finance working capital for Poultry Farm, This facility was extended until 27 September 2012 and bears interest 10.5% annually.

Fasilitas pinjaman yang diperoleh dari Bank Mandiri dijamin dengan jaminan:

Credit facility that obtained from Bank Mandiri was secured by:

Aset tetap berupa tanah, bangunan, sarana

dan prasarana mesin dan peralatan ternak kandang breeding farm dan commercial farmyang diikat dengan Hak Tanggungan sebesar Rp 105.000.000.000;

Fixed assets such as land, buildings, facilities and infrastructure machinery and equipment breeding farm and commercial farm are bounded with First Class Mortgage amounted to Rp 105,000,000,000;

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/52 Exhibit E/52

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

22. UTANG BANK JANGKA PENDEK (Lanjutan) 22. SHORT-TERM BANK LOANS (Continued)

a. PT Bank Negara Indonesia (Persero) Tbk

(Lanjutan) a. PT Bank Negara Indonesia (Persero) Tbk

(Continued)

7 (tujuh) bidang tanah di Desa Gembong, Kecamatan Balaraja, Kabupaten Tangerang, Propinsi Jawa Barat masing-masing dengan Sertifikat Hak Guna Bangunan (SHGB) No. 00068-00073 dan SHGB No. 00075 atas nama Perusahaan dengan jumlah luas seluruhnya 17.754 m2. Seluruh tanah ini telah dibebani Hak Tanggungan Peringkat I sebesar Rp 20.300.000.000 sesuai Sertifikat Hak Tanggungan No. 2734/2009 tanggal 27 Maret 2009 (lihat Catatan 15);

7 (seven) land lot in Gembong Village, Balaraja District, Tangerang Regency, West Java Province, each of these lands was under Building Rights Title Certificates (SHGB) No. 0068-00073 and SHGB No. 00075 under the name of the Company with total 17,754 sqm. All of these lands were bound under contract of First Class Mortgage amounted to Rp 20,300,000,000 equally with Mortgage Certificate No. 2734/2009 dated 27 March 2009 (see Note 15);

2 (dua) bidang tanah yang terletak di Desa

Argapura, Kecamatan Cigudeg, KabupatenBogor, Propinsi Jawa Barat, dengan Sertifikat Hak Guna Bangunan (SHGB) No.3 dan SHGB No. 4 atas nama perusahaan dengan jumlah luas seluruhnya sebesar 113.884 m2. Seluruh tanah ini telah dibebani Hak Tanggungan Peringkat I sebesar Rp 43.878.000.000;

2 (two) land lot in Argapura Village, Cigudeg District, Bogor Regency, West Java Province, each of these lands was under Building Rights Title Certificates (SHGB) No. 3 and SHGB No. 4 under the name of the Company with total 113.884 sqm. All of these lands were bound under contract of First Class Mortgage amoun Rp 43,878,000,000;

Persediaan diikat secara fidusia dengan nilai

penjaminan sebesar Rp 421.545.000.000(lihat Catatan 8) dan telah di daftarkan di Kantor Pendaftaran Fidusia;

Inventories is under fiduciary with a collateral amount of Rp 421,545,000,000(see Note 8) and had been registered in Kantor Pendaftaran Fidusia;

Piutang dagang akan diikat fidusia

dengan nilai penjaminan sebesar Rp 341.717.009.000 yang selanjutnya akan didaftarkan di Kantor Pendaftaran Fidusia.

Trade receivable is under fiduciary with collateral amount of Rp 341,717,009,000 and will be registered in Kantor Pendaftaran Fidusia.

Fasilitas tersebut mensyaratkan antara lain Perusahaan tidak diperkenankan untuk:

This credit facility requires that the Company shall not to:

Mengadakan penggabungan usaha (merger),

atau konsolidasi dengan perusahaan lain; Performing merger, or consolidation with

other company; Mengijinkan pihak lain menggunakan

Perusahaan untuk kegiatan usaha pihak lain; Allowing other parties to use the Company

business to run other parties business; Membayar utang Perusahaan kepada

pemegang saham; Paying the Company's debt to shareholders;

Memberikan pinjaman kepada siapapun juga, termasuk kepada para pemegang saham, kecuali jika pinjaman tersebut diberikan dalam rangka transaksi dagang yang berkaitan langsung dengan usahanya;

Granting loan to anyone, including shareholders, unless if the loan was used in connection with the business operation;

Melakukan akuisisi/pengambilalihan aset milik pihak ketiga, yang bernilai material atau lebih dari 10% dari total ekuitas dalam1 tahun kecuali pengambilalihan aset milik pihak ketiga sebagai akibat langsung dari transaksi dagang; dan

Performing acquisition of third parties assets which have material amount or more than 10% of total equity within 1 year unless acquisition of third parties assets resulting from trading activities; and

Membubarkan Perusahaan dan meminta dinyatakan pailit.

Liquidating the Company and apply for bankruptcy.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/53 Exhibit E/53

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

22. UTANG BANK JANGKA PENDEK (Lanjutan) 22. SHORT-TERM BANK LOANS (Continued)

a. PT Bank Negara Indonesia (Persero) Tbk (Lanjutan)

a. PT Bank Negara Indonesia (Persero) Tbk (Continued)

ii. Berdasarkan Perjanjian Kredit No. 87 tanggal

16 Juni 2009 yang dinyatakan dalam akta Notaris Dr. Irawan Soerodjo, SH, MSi, Notaris di Jakarta, Perusahaan memperoleh tambahan fasilitas kredit dari BNI berupa kredit modal kerja maksimum sebesar Rp 75.000.000.000 untuk keperluan meningkatkan kapasitas produksi pakan ternak minimal 650.000 ton per tahun. Perjanjian ini mengalami perubahan beberapa kali dan terakhir pada tanggal 15 Juni 2011 yang memuat perubahan atas tujuan fasilitas pinjaman, yaitu menjadi tambahan modal kerja untuk industri pakan ternak dan peternakan ayam. Pada tanggal 31 Desember 2011 , saldo pinjaman kredit modal kerja fasilitas maksimum Rp 75.000.000.000 adalah sebesar Rp 74.773.559.550 (2010: Rp 74.616.153.703).

ii. Based on Credit Agreement No. 87 dated 16 June 2009 made before Dr. lrawan Soerodjo, SH, MSi, a Notary in Jakarta, the Company had obtained additional credit facility, working capital loan with maximum credit limit amounted to Rp 75,000,000,000 for the purpose of increasing capacity production of feedmill to a minimum of 650,000 ton per year. This agreement has been amanded for several times and the last amendment on 15 Juni 2011 which contains amendments to the loan facility purpose, is to additional working capital for the animal feed industry and poultry. As of 31 December 2011, outstanding balance of working capital loan maximum facility Rp 75,000,000,000 amounted toRp 74,773,559,550 (2010: Rp 74,616,153,703).

Pinjaman ini dikenakan suku bunga sebesar 10% per tahun (floating rate) dan akan jatuh tempo pada tanggal 15 Juni 2012 dan dapat diperpanjang kembali sesuai dengan kesepakatan kedua belah pihak.

This loan bears a floating interest rate of 10% annually. The loan will mature on 15 June 2012 and might be extended based on consensus of both parties

Jaminan atas fasilitas ini terikat secara Cross Collateralized terhadap fasilitas kredit modal kerja dengan Perjanjian Kredit No. 32 dan No. 33 yang diperoleh Perusahaan dari BNI.

The collateral for this facility was "Cross Collateralized" against working capital loan facility under Letter of Agreement No. 32 and No. 33 obtained from BNI.

Atas pinjaman ini, Perusahaan terikat dengan pembatasan tidak diperkenankan sama dengan yang ditetapkan pada fasilitas kredit modal kerja dengan Perjanjian No. 32 dan 33.

Under this agreement, the Company is bound to several covenants which are corresponding to the working capital loan facility under Letter of Agreements No. 32 and No. 33.

b. PT Bank Mandiri (Persero) Tbk b. PT Bank Mandiri (Persero) Tbk

i. Berdasarkan Perjanjian Kredit No. 198 tanggal

28 September 2010, yang dinyatakan dalam akta Notaris Dr. Irawan Soerodjo, SH, MSi, Notaris di Jakarta, Perusahaan memperoleh pinjaman dari PT Bank Mandiri (Persero) Tbk (Bank Mandiri) berupa fasilitas kredit modal kerja dengan jumlah maksimum sebesar Rp 25.000.000.000 yang digunakan untuk modal kerja peternakan ayam terpadu. Fasilitas ini diperpanjang hingga 27 September 2012 dengan suku bunga sebesar 10,5 % per tahun.

i. Based on Letter of Credit Agreement No. 198 dated 28 September 2010 made before Irawan Soerodjo SH, MSi, a Notary in Jakarta, the Company obtained working capital loan from PT Bank Mandiri (Persero) Tbk (Bank Mandiri) with maximum limit of Rp 25,000,000,000 whichused to finance working capital for Poultry Farm, This facility was extended until 27 September 2012 and bears interest 10.5% annually.

Fasilitas pinjaman yang diperoleh dari Bank Mandiri dijamin dengan jaminan:

Credit facility that obtained from Bank Mandiri was secured by:

Aset tetap berupa tanah, bangunan, sarana

dan prasarana mesin dan peralatan ternak kandang breeding farm dan commercial farmyang diikat dengan Hak Tanggungan sebesar Rp 105.000.000.000;

Fixed assets such as land, buildings, facilities and infrastructure machinery and equipment breeding farm and commercial farm are bounded with First Class Mortgage amounted to Rp 105,000,000,000;

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/55 Exhibit E/55

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

22. UTANG BANK JANGKA PENDEK (Lanjutan) 22. SHORT-TERM BANK LOANS (Continued)

b. PT Bank Mandiri (Persero) Tbk (Lanjutan) b. PT Bank Mandiri (Persero) Tbk (Continued)

iii. Berdasarkan Perjanjian Kredit No.127 tanggal 28 September 2011 yang merupakan addendum II (kedua dari Perjanjian Kredit No. 198 tanggal 28 September 2010) yang dinyatakan dalam akta Notaris Dr. Irawan Soerodjo, SH, Msi, Notaris di Jakarta, Perusahaan mendapatkan tambahan fasilitas kredit dari PT Bank Mandiri (Persero) Tbk, dari fasilitas maksimum Rp 60.000.000.000 (Perjanjian Kredit No. 126) menjadi fasilitas maksimum Rp 150.000.000.000 Pinjaman ini dikenakan suku bunga 10% per tahun dan akan jatuh tempo pada tanggal 27 September 2012.Pada tanggal 31 Desember 2011, saldo pinjaman kredit modal kerja adalah sebesar Rp 147.493.170.371 (2010: Rp 24.791.748.267).

iii. Based on Letter of Credit Agreement No. 127dated 28 September 2011 which is an addendum II (the second of Letter of Credit Agreement No. 198 dated 28 September 2011), made before Irawan Soerodjo SH, MSi, a Notary in Jakarta, the Company had obtained additional credit facility from PT Bank Mandiri (Persero) Tbk from maximum limit of Rp 60,000,000,000 (Letter of Credit Agreement No. 126) to maximum limit of Rp 150,000,000,000. This loan bears interest at 10% annually and will mature on September 27, 2012. As of 31 December 2011, outstanding balance of working capital loan amounted to Rp 147,493,170,371 (2010: Rp 24,791,748,267).

Atas tambahan fasilitas ini, Perusahaan menyerahkan agunan tambahan berupa :

This additional credit facility, the Company submitted additional collateral such as:

Tanah dan bangunan Rumah Potong dan

Pengolahan Ayam dan kantor beserta sarana pelengkap dan mesin-mesin di Parung, Kabupaten Bogor, Jawa Barat yang akan diikat Hak Tanggungan senilai Rp 63.000.000.000;

Land, building slaughterhouse and Processing chicken, offices and supplementary facilities and machinery in Parung, Bogor Regency, West Java which bound under contract of Mortgage amounted to Rp 63,000,000,000;

Tanah dan bangunan kandang ayam, sarana

pelengkap beserta mesin-mesin dan peralatannya di Kabupaten Sukabumi, Jawa Barat yang akan diikat Hak Tanggungan senilai Rp 5.700.000.000;

Land and building of farm, supplementary facilities with machinery and equipments in Sukabumi District, West Java which bound under contract of Mortgage amounted toRp 5,700,000,000;

Tanah dan bangunan kantor DOC, Feedmill

beserta sarana pelengkap dan mesin-mesin di Kabupaten Tanah Laut, propinsi Kalimantan Selatan yang akan diikat Hak Tanggungan senilai Rp 36.000.000.000;

Land and DOC office buildings, feedmill and supplementary facilities and machinery in Tanah Laut District, South Borneo Province which bound under contract of Mortgage amounted to Rp 36,000,000,000;

Persediaan yang akan diikat dengan fidusia

senilai Rp 100.000.000.000; dan Inventory is under fiduciary amounting to

Rp 100,000,000,000; and

Piutang yang akan diikat fidusia senilai Rp 40.000.000.000.

Receivable is under fiduciary amounting to Rp 40,000,000,000;

Jaminan atas fasilitas ini terikat secara Cross Collateralized dan Cross Default dengan jaminan seluruh fasilitas Kredit Perusahaan yang diperoleh dari Bank Mandiri.

The collateral for this facility was "Cross Collateralized" and Cross Default with credit facilities to guarantee all the Company obtained from Bank Mandiri.

c. PT Bank Rakyat Indonesia (Persero) Tbk c. PT Bank Rakyat Indonesia (Persero) Tbk

Berdasarkan Perjanjian Kredit No. 34 tanggal 10 Maret 2010, yang dinyatakan dalam akta Notaris Meri Efda, SH, Notaris di Jakarta, Perusahaan memperoleh pinjaman dari PT Bank Rakyat Indonesia (Persero) Tbk (BRI), berupa pinjaman kredit modal kerja maksimum sebesar Rp 40.000.000.000 yang digunakan untuk membiayai modal kerja usaha. Fasilitas ini berlaku selama 12 bulan dan dikenakan bunga sebesar 13 % per tahun.

Based on Letter of Credit Agreement No. 34 dated 10 March 2010 made before Meri Efda, a Notary in Jakarta, the Company obtained working capital loan from PT Bank Rakyat Indonesia (Persero) Tbk (BRI) with maximum limit of Rp 40,000,000,000 which is used to finance working capital. This facility is valid for 12 months and bears interest 13% annually.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/54 Exhibit E/54

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

22. UTANG BANK JANGKA PENDEK (Lanjutan) 22. SHORT-TERM BANK LOANS (Continued)

b. PT Bank Mandiri (Persero) Tbk (Lanjutan) b. PT Bank Mandiri (Persero) Tbk (Continued)

Piutang dagang diikat fidusia dengan nilai penjaminan sebesar Rp 5.000.000.000;

Trade receivable is under fiduciary amounting to Rp 5,000,000,000;

Persediaan diikat fidusia dengan nilai

penjaminan sebesar Rp 5.000.000.000. Inventory is under fiduciary amounting to

Rp 5,000,000,000.

Fasilitas tersebut mensyaratkan antara lain Perusahaan tidak diperkenankan untuk:

This credit facility requires that the Company shall not to:

Merubah kepemilikan saham yang

mengakibatkan porsi kepemilikan saham PT Sietek Nusantara Finance menurun;

Changing the ownership of shares which resulting decrease in the portion of share ownership in PT Sietek Nusantara Finance;

Memindahtangankan agunan; Transfer of collateral; Mengikat diri sebagai penjamin utang (kecuali

kepada entitas anak) atau menjaminkan harta kekayaan perusahaan yang telah dijaminkan kepada Bank Mandiri kepada pihak lain; dan

Acting as a guarantor of debt (except to the subsidiaries) or companys assets as collateral that has been pledged to Bank Mandiri to other parties; and

Melakukan merger, akuisisi, menjual aset senilai lebih dari 10% dari total aset dalam 1 tahun buku.

Perform merger, acquistision and sale of assets exceed 10% of total asset in 1 accounting year.

Memperoleh pinjaman dari Bank/kreditur lain Getting a loan from Bank / other creditors Melakukan penyertaan kepada perusahaan lain

selain entitas anak. Make investments to companies other than

subsidiaries Mengadakan ekspansi usaha atau investasi

baru; dan Conducting business expansion or new

investment;and Membayar/melunasi utang kepada pemegang

saham. Pay / pay off debt to shareholders.

ii. Berdasarkan Perjanjian Kredit No. 126 tanggal

17 Maret 2011, yang merupakan Addendum I (pertama dari Perjanjian Kredit No. 198 tanggal 28 September 2010), yang dinyatakan dalam akta Notaris Dr. Irawan Soerodjo, SH, Msi, Notaris di Jakarta, Perusahaan mendapatkan tambahan fasilitas kredit dari PT Bank Mandiri (Persero) Tbk, dari fasilitas maksimum Rp 25.000.000.000 (Perjanjian Kredit No. 198) menjadi fasilitas maksimum Rp 60.000.000.000. Pinjaman ini dikenakan suku bunga sebesar 10,5% per tahun dan akan jatuh tempo pada tanggal 27 September 2012.

ii. Based on Letter of Credit Agreement No. 126 dated 17 Maret 2011 which is an Addendum I (the first of Letter of Credit Agreement No. 198 dated 28 September 2011), made before Irawan Soerodjo SH, MSi, a Notary in Jakarta, the Company had obtained additional credit facility from PT Bank Mandiri (Persero) Tbk from maximum limit of Rp 25,000,000,000 (Letter of Credit Agreement No. 198) to maximum limit ofRp 60,000,000,000. This loan bears interest at 10.5% annually and will mature on September 27, 2012.

Atas tambahan fasilitas ini, Perusahaan menambah agunan berupa tanah, bangunan dan prasarana, mesin dan peralatan dengan Hak Tanggungan senilai Rp 35.000.000.000.

This additional credit facility, the Company adds collateral such as land, building and infrastructure machinery and equipment with Mortgage amounted to Rp 35,000,000,000.

Jaminan atas fasilitas ini terikat secara Cross Collateralized dan Cross Default dengan jaminan seluruh fasilitas Kredit Perusahaan yang diperoleh dari Bank Mandiri.

The collateral for this facility was "Cross Collateralized" and Cross Default with credit facilities to guarantee all the Company obtained from Bank Mandiri.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/55 Exhibit E/55

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

22. UTANG BANK JANGKA PENDEK (Lanjutan) 22. SHORT-TERM BANK LOANS (Continued)

b. PT Bank Mandiri (Persero) Tbk (Lanjutan) b. PT Bank Mandiri (Persero) Tbk (Continued)

iii. Berdasarkan Perjanjian Kredit No.127 tanggal 28 September 2011 yang merupakan addendum II (kedua dari Perjanjian Kredit No. 198 tanggal 28 September 2010) yang dinyatakan dalam akta Notaris Dr. Irawan Soerodjo, SH, Msi, Notaris di Jakarta, Perusahaan mendapatkan tambahan fasilitas kredit dari PT Bank Mandiri (Persero) Tbk, dari fasilitas maksimum Rp 60.000.000.000 (Perjanjian Kredit No. 126) menjadi fasilitas maksimum Rp 150.000.000.000 Pinjaman ini dikenakan suku bunga 10% per tahun dan akan jatuh tempo pada tanggal 27 September 2012.Pada tanggal 31 Desember 2011, saldo pinjaman kredit modal kerja adalah sebesar Rp 147.493.170.371 (2010: Rp 24.791.748.267).

iii. Based on Letter of Credit Agreement No. 127dated 28 September 2011 which is an addendum II (the second of Letter of Credit Agreement No. 198 dated 28 September 2011), made before Irawan Soerodjo SH, MSi, a Notary in Jakarta, the Company had obtained additional credit facility from PT Bank Mandiri (Persero) Tbk from maximum limit of Rp 60,000,000,000 (Letter of Credit Agreement No. 126) to maximum limit of Rp 150,000,000,000. This loan bears interest at 10% annually and will mature on September 27, 2012. As of 31 December 2011, outstanding balance of working capital loan amounted to Rp 147,493,170,371 (2010: Rp 24,791,748,267).

Atas tambahan fasilitas ini, Perusahaan menyerahkan agunan tambahan berupa :

This additional credit facility, the Company submitted additional collateral such as:

Tanah dan bangunan Rumah Potong dan

Pengolahan Ayam dan kantor beserta sarana pelengkap dan mesin-mesin di Parung, Kabupaten Bogor, Jawa Barat yang akan diikat Hak Tanggungan senilai Rp 63.000.000.000;

Land, building slaughterhouse and Processing chicken, offices and supplementary facilities and machinery in Parung, Bogor Regency, West Java which bound under contract of Mortgage amounted to Rp 63,000,000,000;

Tanah dan bangunan kandang ayam, sarana

pelengkap beserta mesin-mesin dan peralatannya di Kabupaten Sukabumi, Jawa Barat yang akan diikat Hak Tanggungan senilai Rp 5.700.000.000;

Land and building of farm, supplementary facilities with machinery and equipments in Sukabumi District, West Java which bound under contract of Mortgage amounted toRp 5,700,000,000;

Tanah dan bangunan kantor DOC, Feedmill

beserta sarana pelengkap dan mesin-mesin di Kabupaten Tanah Laut, propinsi Kalimantan Selatan yang akan diikat Hak Tanggungan senilai Rp 36.000.000.000;

Land and DOC office buildings, feedmill and supplementary facilities and machinery in Tanah Laut District, South Borneo Province which bound under contract of Mortgage amounted to Rp 36,000,000,000;

Persediaan yang akan diikat dengan fidusia

senilai Rp 100.000.000.000; dan Inventory is under fiduciary amounting to

Rp 100,000,000,000; and

Piutang yang akan diikat fidusia senilai Rp 40.000.000.000.

Receivable is under fiduciary amounting to Rp 40,000,000,000;

Jaminan atas fasilitas ini terikat secara Cross Collateralized dan Cross Default dengan jaminan seluruh fasilitas Kredit Perusahaan yang diperoleh dari Bank Mandiri.

The collateral for this facility was "Cross Collateralized" and Cross Default with credit facilities to guarantee all the Company obtained from Bank Mandiri.

c. PT Bank Rakyat Indonesia (Persero) Tbk c. PT Bank Rakyat Indonesia (Persero) Tbk

Berdasarkan Perjanjian Kredit No. 34 tanggal 10 Maret 2010, yang dinyatakan dalam akta Notaris Meri Efda, SH, Notaris di Jakarta, Perusahaan memperoleh pinjaman dari PT Bank Rakyat Indonesia (Persero) Tbk (BRI), berupa pinjaman kredit modal kerja maksimum sebesar Rp 40.000.000.000 yang digunakan untuk membiayai modal kerja usaha. Fasilitas ini berlaku selama 12 bulan dan dikenakan bunga sebesar 13 % per tahun.

Based on Letter of Credit Agreement No. 34 dated 10 March 2010 made before Meri Efda, a Notary in Jakarta, the Company obtained working capital loan from PT Bank Rakyat Indonesia (Persero) Tbk (BRI) with maximum limit of Rp 40,000,000,000 which is used to finance working capital. This facility is valid for 12 months and bears interest 13% annually.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/57 Exhibit E/57

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

22. UTANG BANK JANGKA PENDEK (Lanjutan) 22. SHORT-TERM BANK LOANS (Continued)

d. Raiffeisen Bank International (Lanjutan) d. Raiffeisen Bank International (Continued)

Fasilitas ini ditujukan untuk membiayai pembelian dan penyimpanan jagung, tepung kedelai (soyabean meal), kacang kedelai (soybeans), tepung jagung (corn glutten meal), meat bone meal, tepung lobak (rapeseed meal) impor atau produk lainnya yang dapat diterima. Fasilitas ini dijamin dengan persediaan dan perjanjian Tripartite Collateral Manajemen antara Perusahaan, RBI dan PT Sucofindo (Persero).

These facilities shall be used to finance the purchase and storage of imported corn, soyabean meal, soybeans, corn glutten meal, meat bone meal, rapeseed meal or other acceptable products. These facilities are secured by inventories, with Tripartite Collateral Management Agreement between the Company, RBI and PT Sucofindo (Persero).

Sesuai dengan surat No. LO11/067/TCF/WE/ja tanggal 15 Juli 2011 dari RBI bahwa fasilitas pembiayaan dapat dipergunakan untuk pembiayaan atas pembelian dari suplier lokal. Fasilitas ini telah diperpanjang untuk jangka waktu satu tahun.

In accordance Letter No. L011/067/TFC/WE/ja dated 15 July 2011 from RBI that the financing facility can be used to finance the purchase from local supplier. This facility has been extended for a periode of one year.

Perusahaan harus menjaga rasio pinjaman terhadap jaminan kurang dari 70%. Pada tanggal 31 Desember 2011 saldo pinjaman atas fasilitas ini adalah nihil (2010: USD 4.680.033,82 atau setara dengan Rp 42.078.184.063).

The Company should maintain loan to collateral ratio below 70%. As of 31 December 2011 the outstanding balance on this facility is nil (2010: USD 4,680,033.82 or equivalent to Rp 42,078,184,063).

e. PT Bank Bukopin Tbk e. PT Bank Bukopin Tbk

Berdasarkan surat perjanjian pemberian fasilitas Line Letter of Credit (LC) No. XLI/053/BUKI/PK-LC/IV/2011 tanggal 5 April 2011, PT Sierad Industries (entitas anak) memperoleh fasilitas LC dalam bentuk Sight Letter of Credit dari PT Bank Bukopin Tbk (Bukopin) dengan maksimum kredit sampai dengan USD 2.000.000 yang akan dipergunakan untuk impor bahan baku (Hot-Dip Galvanized Steel Sheet in Coil).

Based on Letter Agreement facilitation Line Letter of Credit (LC) No. XLI/053/BUKI/PK-LC/IV/2011 dated5 April 2011, PT Sierad Industries (subsidiary) hadobtained LC facilities such as Sight Letter of Credit from PT Bank Bukopin Tbk (Bukopin) with maximum credit up to USD 2,000,000 which will be used to import raw materials (Hot-Dip Galvanized Steel Sheet in Coil).

Jangka waktu fasilitas LC adalah 12 bulan sejak tanggal penerbitan LC pertama kali. Fasilitas ini dijamin dengan menyerahkan agunan berupa dana yang ditempatkan dalam bentuk Deposito pada Bukopin senilai 100% dari setiap nominal LC yang diterbitkan tercatat atas nama PT Sierad Industries.

LC facility period is 12 months since the date of issuance of the first LC. This facility is guaranteed by collateral such as fund issued in a Deposit at Bukopin a 100% of each nominal LC issued registered in the name PT Sierad Industries.

Pada tanggal 31 Desember 2011, saldo pinjaman fasilitas ini adalah nihil.

As of 31 December 2011, the outstanding balance of this facility is nil.

23. UTANG BANK JANGKA PANJANG 23. LONG-TERM BANK LOANS

2 0 1 1 2 0 1 0 Fasilitas Kredit Investasi : Investment Credit Facilities :PT Bank Negara Indonesia PT Bank Negara Indonesia (Persero) Tbk (a) 123.639.108.295 25.048.525.150 (Persero) Tbk (a) PT Bank Mandiri (Persero)Tbk (c) 117.500.000.000 75.000.000.000 PT Bank Mandiri (Persero) Tbk (c)PT CIMB Niaga Tbk (d) 25.400.000.000 25.400.000.000 PT CIMB Niaga Tbk (d)PT Bank Bukopin Tbk (b) 22.000.000.000 - PT Bank Bukopin Tbk (b) Fasilitas Kredit Modal Kerja : Working Capital Loan :PT Bank Bukopin Tbk (b) 75.000.000.000 75.000.000.000 PT Bank Bukopin Tbk (b)

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/56 Exhibit E/56

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

22. UTANG BANK JANGKA PENDEK (Lanjutan) 22. SHORT-TERM BANK LOANS (Continued)

c. PT Bank Rakyat Indonesia (Persero) Tbk (Lanjutan) c. PT Bank Rakyat Indonesia (Persero) Tbk (Continued)

Pada tanggal 31 Desember 2011, saldo pinjaman kredit modal kerja adalah nihil (2010: Rp 39.982.464.774).Fasilitas pinjaman ini sudah ditutup oleh Perusahaan pada tahun 2011.

As of 31 December 2011, outstanding balance of working capital loan amounted to nil (2010: Rp 39,982,464,774). This loan facility has been closed by the Company in 2011.

Fasilitas pinjaman yang diperoleh dari BRI dijamin dengan jaminan:

Credit facility that is obtained from BRI was secured by:

3 (tiga) bidang tanah yang terletak di Desa Jabon

Mekar, Kecamatan Parung, Kabupaten Bogor, Propinsi Jawa Barat dengan SHGB No. 34, SHGB No. 35 dan SHGB No. 36, atas nama Perusahaan dengan luas seluruhnya sebesar 53.286 m2 sebesar yang diikat dengan Hak Tanggungan Peringkat I sebesar Rp 24.263.000.000.

3 (three) land lot in Jabon Mekar Village, Parung District, Bogor Regency, West Jabar Province, with SHGB No. 34, SHGB No 35 and SHGB No. 36 with total area of 53.286 sqm under the name of the Company which bound under contract of First Class Mortgage amounted to Rp 24,263,000,000.

Mesin dan peralatan pabrik diikat dengan fidusia

sebesar Rp 29.489.000.000 dan didaftarkan ke Kantor Pendaftaran Fidusia.

Factory machineries and equipment are under fiduciary amounted to Rp 29,489,000,000 and registered in Kantor Pendaftaran Fidusia.

Kendaraan diikat dengan fidusia sebesar

Rp 1.667.000.000. Vehicles are under fiduciary amounted to

Rp 1,667,000,000

Fasilitas tersebut mensyaratkan antara lain Perusahaan tidak diperkenankan untuk:

This credit facility requires that the Company shall not to:

Melakukan penyertaan saham, kecuali yang sudah

ada saat ini dan sepanjang cash flow tidak terganggu serta net working capital masih positif;

Invested in shares, except that have already exist today and throughout the cash flow is notdisturbed and the net working capital is still positive;

Memberikan piutang kepada pemegang saham; Providing loans to shareholders; Melunasi utang kepada pemegang saham sebelum

utang di BRI dilunasi terlebih dahulu; Paying the debt to shareholders prior to the Bank

Loans; Melakukan investasi, perluasan usaha dan

penjualan aset Perusahaan melebihi 20% dari modal Perusahaan;

Making investment, business expansion and sales of the Companys assets exceed 20% of the capital of the Company;

Menyewakan aset yang dijaminkan di BRI kepada pihak lain; dan

Rent out the secured assets in the BRI to other parties; and

Mengajukan permohonan pernyataan pailit kepada Pengadilan Niaga untuk menyatakan pailit dari debitur sendiri.

Filing a bankruptcy petition to the Commercial Court to declare bankruptcy of the debtor itself.

Pada tanggal 10 Oktober 2011 melalui surat No. 227/Corp-CS-K/X-11, Perusahaan melakukan penutupan rekening pinjaman dan pengambilan dokumen jaminan.

On 10 October 2011 by letter No. 227/Corp-CS-K/X-11, the Company made a loan account closing and warranty document retrieval.

d. Raiffeisen Bank International d. Raiffeisen Bank International

Raiffeisen Bank International (RBI) menawarkan fasilitas pembiayaan niaga tidak terikat (Uncommitted Trade Finance Facilities) sebesar USD 10.000.000 melalui surat No. LO10/071/TCF/WT tertanggal 21 Juli 2010 dan Perusahaan telah menerima penawaran tersebut. Fasilitas ini terdiri dari Sight LC Facility(LCF), Import Loan Facility (ILF) dengan jangka waktu maksimum 60 hari, Trust Receipt Facility(IFF) dengan jangka waktu maksimum 60 hari dan Inventory Financing Facility (INVF) dengan jangka waktu maksimum 120 hari.

Raiffeisen Bank International (RBI) offered uncommitted trade finance facilities amounted to USD 10,000,000 through the letter No. LO10/071/TCF/WT dated 21 July 2010 and the Company accepted the offer. These facilities consist of Sight LC Facility (LCF), Import Loan Facility (ILF) maximum 60 days, Trust Receipt Facility (IFF) maximum 60 days and Inventory Financing Facility (INVF) maximum 120 days.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/57 Exhibit E/57

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

22. UTANG BANK JANGKA PENDEK (Lanjutan) 22. SHORT-TERM BANK LOANS (Continued)

d. Raiffeisen Bank International (Lanjutan) d. Raiffeisen Bank International (Continued)

Fasilitas ini ditujukan untuk membiayai pembelian dan penyimpanan jagung, tepung kedelai (soyabean meal), kacang kedelai (soybeans), tepung jagung (corn glutten meal), meat bone meal, tepung lobak (rapeseed meal) impor atau produk lainnya yang dapat diterima. Fasilitas ini dijamin dengan persediaan dan perjanjian Tripartite Collateral Manajemen antara Perusahaan, RBI dan PT Sucofindo (Persero).

These facilities shall be used to finance the purchase and storage of imported corn, soyabean meal, soybeans, corn glutten meal, meat bone meal, rapeseed meal or other acceptable products. These facilities are secured by inventories, with Tripartite Collateral Management Agreement between the Company, RBI and PT Sucofindo (Persero).

Sesuai dengan surat No. LO11/067/TCF/WE/ja tanggal 15 Juli 2011 dari RBI bahwa fasilitas pembiayaan dapat dipergunakan untuk pembiayaan atas pembelian dari suplier lokal. Fasilitas ini telah diperpanjang untuk jangka waktu satu tahun.

In accordance Letter No. L011/067/TFC/WE/ja dated 15 July 2011 from RBI that the financing facility can be used to finance the purchase from local supplier. This facility has been extended for a periode of one year.

Perusahaan harus menjaga rasio pinjaman terhadap jaminan kurang dari 70%. Pada tanggal 31 Desember 2011 saldo pinjaman atas fasilitas ini adalah nihil (2010: USD 4.680.033,82 atau setara dengan Rp 42.078.184.063).

The Company should maintain loan to collateral ratio below 70%. As of 31 December 2011 the outstanding balance on this facility is nil (2010: USD 4,680,033.82 or equivalent to Rp 42,078,184,063).

e. PT Bank Bukopin Tbk e. PT Bank Bukopin Tbk

Berdasarkan surat perjanjian pemberian fasilitas Line Letter of Credit (LC) No. XLI/053/BUKI/PK-LC/IV/2011 tanggal 5 April 2011, PT Sierad Industries (entitas anak) memperoleh fasilitas LC dalam bentuk Sight Letter of Credit dari PT Bank Bukopin Tbk (Bukopin) dengan maksimum kredit sampai dengan USD 2.000.000 yang akan dipergunakan untuk impor bahan baku (Hot-Dip Galvanized Steel Sheet in Coil).

Based on Letter Agreement facilitation Line Letter of Credit (LC) No. XLI/053/BUKI/PK-LC/IV/2011 dated5 April 2011, PT Sierad Industries (subsidiary) hadobtained LC facilities such as Sight Letter of Credit from PT Bank Bukopin Tbk (Bukopin) with maximum credit up to USD 2,000,000 which will be used to import raw materials (Hot-Dip Galvanized Steel Sheet in Coil).

Jangka waktu fasilitas LC adalah 12 bulan sejak tanggal penerbitan LC pertama kali. Fasilitas ini dijamin dengan menyerahkan agunan berupa dana yang ditempatkan dalam bentuk Deposito pada Bukopin senilai 100% dari setiap nominal LC yang diterbitkan tercatat atas nama PT Sierad Industries.

LC facility period is 12 months since the date of issuance of the first LC. This facility is guaranteed by collateral such as fund issued in a Deposit at Bukopin a 100% of each nominal LC issued registered in the name PT Sierad Industries.

Pada tanggal 31 Desember 2011, saldo pinjaman fasilitas ini adalah nihil.

As of 31 December 2011, the outstanding balance of this facility is nil.

23. UTANG BANK JANGKA PANJANG 23. LONG-TERM BANK LOANS

2 0 1 1 2 0 1 0 Fasilitas Kredit Investasi : Investment Credit Facilities :PT Bank Negara Indonesia PT Bank Negara Indonesia (Persero) Tbk (a) 123.639.108.295 25.048.525.150 (Persero) Tbk (a) PT Bank Mandiri (Persero)Tbk (c) 117.500.000.000 75.000.000.000 PT Bank Mandiri (Persero) Tbk (c)PT CIMB Niaga Tbk (d) 25.400.000.000 25.400.000.000 PT CIMB Niaga Tbk (d)PT Bank Bukopin Tbk (b) 22.000.000.000 - PT Bank Bukopin Tbk (b) Fasilitas Kredit Modal Kerja : Working Capital Loan :PT Bank Bukopin Tbk (b) 75.000.000.000 75.000.000.000 PT Bank Bukopin Tbk (b)

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/59 Exhibit E/59

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

23. UTANG BANK JANGKA PANJANG (Lanjutan) 23. LONG-TERM BANK LOANS (Continued)

a. PT Bank Negara Indonesia (Persero) Tbk (Lanjutan) a. PT Bank Negara Indonesia (Persero) Tbk (Continued)

Jangka waktu pinjaman adalah sejak tanggal penandatanganan perjanjian kredit sampai dengan bulan Januari 2015, termasuk masa tenggang (grace period) sampai dengan bulan Januari 2011 dengan suku bunga sebesar 11,5% per tahun. Pada tanggal 31 Desember 2011, saldo pinjaman fasilitas ini adalah sebesar Rp 6.766.530.001 (2010: Rp 8.258.327.063).

The term of this loan is starting from the signing date of agreement up to January 2015 which includes a grace period until January 2011 and bears interest 11,5% annually. As of 31 December 2011, outstanding balance of this facility was Rp 6,766,530,001 (2010: Rp 8,258,327,063).

Jaminan atas fasilitas ini terikat secara Cross Collateralized terhadap fasilitas kredit modal kerja dengan Perjanjian Kredit No. 32 dan No. 33 yang diperoleh Perusahaan dari BNI.

The collateral for this facility was "Cross Collateralized" against working capital loan facility under Letter of Agreements No. 32 and No. 33 obtained from BNI.

Atas pinjaman ini, Perusahaan terikat dengan pembatasan tidak diperkenankan sama dengan yang ditetapkan pada fasilitas kredit modal kerja dengan Perjanjian No. 32 dan 33.

Under this agreement, the Company is bound to several covenants which are corresponding to the working capital loan facility under Letter of Agreements No. 32 and No. 33.

iii. Berdasarkan Perjanjian Kredit No. 281 tanggal

28 Juli 2010 yang dinyatakan dalam akta Notaris Dr. Irawan Soerodjo, SH, MSi, Notaris di Jakarta, Perusahaan memperoleh fasilitas kredit investasi dari PT Bank Negara Indonesia (Persero) Tbk (BNI) dengan maksimum kredit sampai dengan Rp 149.672.000.000 untuk keperluan pembangunan breeding farm di Desa Asih, Kecamatan Curugbitung dan Desa Sukarame, Kecamatan Sajira, keduanya terletak di Kabupaten Lebak, Propinsi Banten. Jangka waktu pinjaman adalah sejak tanggal penandatanganan perjanjian kredit sampai dengan bulan Juli 2017, termasuk masa tenggang (grace period) selama 24 bulan dengan suku bunga sebesar 11,5% per tahun. Pada tanggal 31 Desember 2011, saldo pinjaman fasilitas ini adalah sebesar Rp 100.933.509.485.

iii. Based on Credit Agreement No. 281 made before Dr. lrawan Soerodjo, SH, MSi, a Notary in Jakarta, dated 28 July 2010, the Company obtained an investment credit facility from PT Bank Negara Indonesia (Persero) Tbk (BNI) with maximum credit limit amounted to Rp 149,672,000,000. The purpose of this loan is to support construction of breeding project in Asih Village, Curugbitung Sub-distric and Sukarame Village, Sajira Sub-distric, both is located in the Lebak District, Banten Province. The term of this loan is starting from the signing date of agreement up to July 2017 which includes a grace period for 24 months and bears interest 11,5% annually. As of 31 December 2011, outstanding balance of this facility was Rp 100,933,509,485.

Jaminan atas fasilitas ini adalah tanah beserta peralatan operasional dengan total nilai sebesar Rp 231.000.000.000 dan terikat secara Cross Collateralized terhadap fasilitas kredit modal kerja dengan Perjanjian Kredit No. 32 dan No. 33 yang diperoleh Perusahaan dari BNI.

The collateral for this facility was land and operational equipments with total amount Rp 231,000,000,000 and "Cross Collateralized" against working capital loan facility under Letter of Agreements No. 32 and No. 33 obtained from BNI.

Atas pinjaman ini, Perusahaan terikat dengan pembatasan tidak diperkenankan sama dengan yang ditetapkan pada fasilitas kredit modal kerja dengan Perjanjian No. 32 dan 33.

Under this agreement, the Company is bound to several covenants which are corresponding to the working capital loan facility under Letter of Agreements No. 32 and No. 33.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/58 Exhibit E/58

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

23. UTANG BANK JANGKA PANJANG (Lanjutan) 23. LONG-TERM BANK LOANS (Continued)

2 0 1 1 2 0 1 0 Fasilitas Line Letter of Credit : Line Letter of Credit Facilities : PT Bank Bukopin (b) 149.708.209.204 - PT Bank Bukopin (b)

513.247.317.499 200.448.525.150

Biaya transaksi belum diamortisasi ( 4.842.807.320) ( 1.386.525.619) Unamortized transaction cost 508.404.510.179 199.061.999.531 Dikurangi : Bagian yang jatuh tempo Less : Current maturity of

dalam satu tahun ( 106.371.250.161 )( 13.753.102.407) long-term bank loan Bagian Jangka Panjang 402.033.260.018 185.308.897.124 Long-Term Bank Loans

a. PT Bank Negara Indonesia (Persero) Tbk a. PT Bank Negara Indonesia (Persero) Tbk

i. Berdasarkan Perjanjian Kredit No. 88 tanggal

16 Juni 2009 yang dinyatakan dalam akta Notaris Dr. Irawan Soerodjo, SH, MSi, Notaris di Jakarta, Perusahaan memperoleh tambahan fasilitas kredit investasi dari PT Bank Negara Indonesia (Persero) Tbk (BNI) dengan maksimum kredit sampai dengan Rp 21.500.000.000 untuk keperluan pembangunan kandang ayam di Desa Argapura, Kecamatan Cigudeg, Kabupaten Bogor, Propinsi Jawa Barat. Jangka waktu pinjaman adalah sejak tanggal penandatanganan perjanjian kredit sampai dengan bulan Maret 2014, termasuk masa tenggang (grace period) sampai dengan bulan Desember 2009 dengan suku bunga sebesar 14% per tahun. Perjanjian ini mengalami perubahan beberapa kali, terakhir pada 28 Juli 2010. Pada tanggal 31 Desember 2011, saldo pinjaman kredit investasi adalah sebesar Rp 11.932.996.897 (2010: Rp 16.539.821.033).

i. Based on Credit Agreement No. 88 made before Dr. lrawan Soerodjo, SH, MSi, a Notary in Jakarta, dated 16 June 2009, the Company obtained an additional investment credit facility from PT Bank Negara Indonesia (Persero) Tbk (BNI) with maximum credit limit amounted to Rp 21,500,000,000. The purpose of this loan is to support construction of farm project in Argapura Village, Cigudeg District, Bogor Regency, West Java Province. The term of this loan is starting from the signing date of agreement up to March 2014 which includes a grace period until December 2009 and charged an annual interest of 14%. This agreement has been amended for several times and the last amendment was 28 July 2010. As of 31 December 2011, outstanding balance of this facility was Rp 11,932,996,898 (2010: Rp 16,539,821,033).

Jaminan atas fasilitas ini terikat secara Cross Collateralized terhadap fasilitas kredit modal kerja dengan Perjanjian Kredit No. 32 dan No. 33 yang diperoleh Perusahaan dari BNI (lihat Catatan 22).

The collateral for this facility is "Cross Collateralized" corresponding to working capital loan facility under Letter of Agreements No. 32 and No. 33 obtained from BNI (see Note 22).

Atas pinjaman ini, Perusahaan terikat dengan pembatasan tidak diperkenankan sama dengan yang ditetapkan pada fasilitas kredit modal kerjadengan Perjanjian No. 32 dan 33 (lihat Catatan 22).

Under this agreement, the Company is bound to several covenants which are similar to the working capital loan facility under Letter of Agreement No. 32 and No. 33 (see Note 22).

ii. Berdasarkan Perjanjian Kredit No. 283 tanggal

28 Juli 2010 yang dinyatakan dalam akta Notaris Dr. Irawan Soerodjo, SH, MSi, Notaris di Jakarta, Perusahaan memperoleh tambahan fasilitas kredit investasi dari PT Bank Negara Indonesia (Persero) Tbk (BNI) dengan maksimum kredit sampai dengan Rp 8.291.000.000 untuk keperluan pembangunan kandang ayam di Desa Cigudeg, Kabupaten Bogor, Propinsi Jawa Barat.

ii. Based on Credit Agreement No. 283 made before Dr. lrawan Soerodjo, SH, MSi, a Notary in Jakarta, dated 28 July 2010, the Company obtained an additional investment credit facility from PT Bank Negara Indonesia (Persero) Tbk (BNI) with maximum credit limit amounted to Rp 8,291,000,000. The purpose of this loan is to support construction of farm project in Cigudeg Village, Bogor Regency, West Java Province.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/59 Exhibit E/59

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

23. UTANG BANK JANGKA PANJANG (Lanjutan) 23. LONG-TERM BANK LOANS (Continued)

a. PT Bank Negara Indonesia (Persero) Tbk (Lanjutan) a. PT Bank Negara Indonesia (Persero) Tbk (Continued)

Jangka waktu pinjaman adalah sejak tanggal penandatanganan perjanjian kredit sampai dengan bulan Januari 2015, termasuk masa tenggang (grace period) sampai dengan bulan Januari 2011 dengan suku bunga sebesar 11,5% per tahun. Pada tanggal 31 Desember 2011, saldo pinjaman fasilitas ini adalah sebesar Rp 6.766.530.001 (2010: Rp 8.258.327.063).

The term of this loan is starting from the signing date of agreement up to January 2015 which includes a grace period until January 2011 and bears interest 11,5% annually. As of 31 December 2011, outstanding balance of this facility was Rp 6,766,530,001 (2010: Rp 8,258,327,063).

Jaminan atas fasilitas ini terikat secara Cross Collateralized terhadap fasilitas kredit modal kerja dengan Perjanjian Kredit No. 32 dan No. 33 yang diperoleh Perusahaan dari BNI.

The collateral for this facility was "Cross Collateralized" against working capital loan facility under Letter of Agreements No. 32 and No. 33 obtained from BNI.

Atas pinjaman ini, Perusahaan terikat dengan pembatasan tidak diperkenankan sama dengan yang ditetapkan pada fasilitas kredit modal kerja dengan Perjanjian No. 32 dan 33.

Under this agreement, the Company is bound to several covenants which are corresponding to the working capital loan facility under Letter of Agreements No. 32 and No. 33.

iii. Berdasarkan Perjanjian Kredit No. 281 tanggal

28 Juli 2010 yang dinyatakan dalam akta Notaris Dr. Irawan Soerodjo, SH, MSi, Notaris di Jakarta, Perusahaan memperoleh fasilitas kredit investasi dari PT Bank Negara Indonesia (Persero) Tbk (BNI) dengan maksimum kredit sampai dengan Rp 149.672.000.000 untuk keperluan pembangunan breeding farm di Desa Asih, Kecamatan Curugbitung dan Desa Sukarame, Kecamatan Sajira, keduanya terletak di Kabupaten Lebak, Propinsi Banten. Jangka waktu pinjaman adalah sejak tanggal penandatanganan perjanjian kredit sampai dengan bulan Juli 2017, termasuk masa tenggang (grace period) selama 24 bulan dengan suku bunga sebesar 11,5% per tahun. Pada tanggal 31 Desember 2011, saldo pinjaman fasilitas ini adalah sebesar Rp 100.933.509.485.

iii. Based on Credit Agreement No. 281 made before Dr. lrawan Soerodjo, SH, MSi, a Notary in Jakarta, dated 28 July 2010, the Company obtained an investment credit facility from PT Bank Negara Indonesia (Persero) Tbk (BNI) with maximum credit limit amounted to Rp 149,672,000,000. The purpose of this loan is to support construction of breeding project in Asih Village, Curugbitung Sub-distric and Sukarame Village, Sajira Sub-distric, both is located in the Lebak District, Banten Province. The term of this loan is starting from the signing date of agreement up to July 2017 which includes a grace period for 24 months and bears interest 11,5% annually. As of 31 December 2011, outstanding balance of this facility was Rp 100,933,509,485.

Jaminan atas fasilitas ini adalah tanah beserta peralatan operasional dengan total nilai sebesar Rp 231.000.000.000 dan terikat secara Cross Collateralized terhadap fasilitas kredit modal kerja dengan Perjanjian Kredit No. 32 dan No. 33 yang diperoleh Perusahaan dari BNI.

The collateral for this facility was land and operational equipments with total amount Rp 231,000,000,000 and "Cross Collateralized" against working capital loan facility under Letter of Agreements No. 32 and No. 33 obtained from BNI.

Atas pinjaman ini, Perusahaan terikat dengan pembatasan tidak diperkenankan sama dengan yang ditetapkan pada fasilitas kredit modal kerja dengan Perjanjian No. 32 dan 33.

Under this agreement, the Company is bound to several covenants which are corresponding to the working capital loan facility under Letter of Agreements No. 32 and No. 33.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/61 Exhibit E/61

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

23. UTANG BANK JANGKA PANJANG (Lanjutan) 23. LONG-TERM BANK LOANS (Continued)

b. PT Bank Bukopin Tbk (Lanjutan) b. PT Bank Bukopin Tbk (Continued)

2 (dua) bidang tanah dan bangunan yang terletak di Desa Agrapura, Kecamatan Cigudeg, Kabupaten Bogor, Propinsi Jawa Barat dengan SHGB No. 5 seluas 72.460 m2 dan SHGB No. 6 seluas 79.000 m2 yang tercatat atas nama Perusahaan;

2 (two) land lot and building in Argapura Village, Cigudeg District, Bogor Regency, West Jabar Province, with SHGB No. 5 of 72.460 sqm and SHGB No.6 79.000 sqm registered with the name of the Company;

3 Bidang tanah dengan SHGB No.1 seluas 95.725

m2, SHGB No. 2 seluas 76.945 m2 dan SHGB No. 5 seluas 62.395 yang terletak di Desa Cijulang, Kecamatan Jampang Tengah, Kabupaten Sukabumi, Propinsi Jawa Barat yang terdaftar atas nama Perusahaan.

3 land lot with an area of 95,725 sqm with SHGB No.1, area of 76,945 sqm with SHGB No. 2 and area of 62,395 sqm with SHGBNo. 3 located in the Cijulang Village, Middle Jampang District, Sukabumi Regency, West Java Province, which are registered under the name of the Company.

3 Bidang tanah dengan SHGB No.1 seluas 43.180

m2, SHGB No. 2 seluas 88.690 m2 dan SHGB No. 10 seluas 43.180 m2 yang terletak di Desa Cijulang, Kecamatan Jampang Tengah, Kabupaten Sukabumi, Propinsi Jawa Barat yang terdaftar atas nama Perusahaan.

3 land lot with an area of 43,180 sqm with SHGB No.1, area of 88,690 sqm with SHGB No. 2 and area of 43,180 sqm with SHGB No. 10 located in the Cijulang Village, Middle Jampang District, Sukabumi Regency, West Java Province, which are registered under the name of the Company.

Mesin dan peralatan Breeding Farm dengan

total nilai penjaminan Rp 16.556.900.000. Machineries and equipment Breeding Farm

with collateral amount Rp 16,556,900,000.

ii. Berdasarkan Perjanjian Kredit No. 71 tanggal 5 April 2011 yang dinyatakan dalam akta Notaris Arry Supratno, SH, Notaris di Jakarta, Perusahaan memperoleh fasilitas line Letter of Credit (LC)/ Surat Kredit Berdokumen Dalam Negeri (SKBDN) dalam bentuk Sight LC dengan maksimum kredit sebesar USD 20,000,000 atau setara dengan Rp 180.000.000.000 dengan tujuan untuk pembelian bahan baku pakan ternak (impor dan lokal). Jangka waktu fasilitas LC/SKBDN adalah 24 bulan, sejak tanggal penandatanganan perjanjian kredit sampai dengan 5 April 2013 dan dikenakan bunga sebesar 5% per tahun jika dalam mata uang USD (Dollar Amerika Serikat) atau 11% per tahun jika dalam mata uang IDR (Indonesia Rupiah).

ii. Based on Credit Agreement No. 71 made before Arry Supratno, SH, a notary in Jakarta, dated 5 April 2011, the Company obtained Line Letter of Credit (LC) facility/Domestic Letter of Credit Documented (SKBDN) such as Sight LC with maximum credit of USD 20,000,000 or equivalent to Rp 180,000,000,000 with the purpose to purchase of feed raw material (import and local).LC facility period is 24 months, since date of signing the loan agreement up to 5 April 2013 and bears a floating interest rate of 5% annually if the currency in USD (U.S Dollar) or 11% annually ifthe currency in IDR (Indonesian Rupiah).

Atas fasilitas tersebut diatas, Perusahaan menambah agunan yang terdiri dari:

The above facility, the Company added collateral such as:

Persediaan bahan baku pakan ternak yang

dibiayai dengan fasilitas ini minimal 83.000 ton ekuivalen dengan Rp 250.000.000.000.

Inventory of feed raw material was financed with minimum facility of 83,000.ton equivalent with Rp 250,000,000,000.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/60 Exhibit E/60

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

23. UTANG BANK JANGKA PANJANG (Lanjutan) 23. LONG-TERM BANK LOANS (Continued)

a. PT Bank Negara Indonesia (Persero) Tbk (Lanjutan) a. PT Bank Negara Indonesia (Persero) Tbk (Continued)

iv. Berdasarkan Perjanjian Kredit No. 282 tanggal

28 Juli 2010 yang dinyatakan dalam akta Notaris Dr. Irawan Soerodjo, SH, MSi, Notaris di Jakarta, Perusahaan memperoleh fasilitas kredit investasi IDC (Interest During Construction) dari PT Bank Negara Indonesia (Persero) Tbk (BNI) dengan maksimum kredit sampai dengan Rp 15.505.000.000 untuk keperluan pembangunan menampung 65% liabilitas bunga yang timbul selama masa pembangunan breeding farm di Desa Asih, Kecamatan Curugbitung dan Desa Sukarame, Kecamatan Sajira, keduanya terletak di Kabupaten Lebak, Propinsi Banten. Jangka waktu pinjaman adalah sejak tanggal penandatanganan perjanjian kredit sampai dengan bulan Juli 2017, termasuk masa tenggang (grace period) selama 24 bulan dengan suku bunga sebesar 11,5% per tahun. Pada tanggal 31 Desember 2011, saldo pinjaman fasilitas ini adalah sebesar Rp 2.985.880.268.

iv. Based on Credit Agreement No. 282 made before Dr. lrawan Soerodjo, SH, MSi, a Notary in Jakarta, dated 28 July 2010, the Company obtained an IDC (Interest During Construction) investment credit facility from PT Bank Negara Indonesia (Persero) Tbk (BNI) with maximum credit limit amounted to Rp 15,505,000,000. The purpose of this loan is to support construction of 65% interest liability during the breeding farm development in Asih Village, Curugbitung Sub-distric and Sukarame Village, Sajira Sub-distric, both is located in the Lebak District, Banten Province. The term of this loan is starting from the signing date of agreement up to July 2017 which includes a grace period for 24 months and bears interest 11,5% annually. As of 31 December 2011, outstandingbalance of this facility was Rp 2,985,880,268.

Jaminan atas fasilitas ini terikat secara Cross Collateralized terhadap fasilitas kredit modal kerja dengan Perjanjian Kredit No. 32, No. 33 dan No. 281 yang diperoleh Perusahaan dari BNI.

The collateral for this facility was "Cross Collateralized" against working capital loan facility under Letter of Agreements No. 32, No. 33 and No. 281 obtained from BNI.

Atas pinjaman ini, Perusahaan terikat dengan pembatasan tidak diperkenankan sama dengan yang ditetapkan pada fasilitas kredit modal kerja dengan Perjanjian No. 32 dan 33.

Under this agreement, the Company is bound to several covenants which are corresponding to the working capital loan facility under Letter of Agreements No. 32 and No. 33.

b. PT Bank Bukopin Tbk b. PT Bank Bukopin Tbk

i. Berdasarkan Perjanjian Kredit No. 28 tanggal

26 Juli 2010 yang dinyatakan dalam akta Notaris Tetty Herawati Soebroto, SH, MH, Notaris di Jakarta, Perusahaan memperoleh fasilitas kredit dari PT Bank Bukopin Tbk (Bukopin) dengan maksimum kredit sampai dengan Rp 40.000.000.000 yang digunakan untuk modal kerja operasional perusahaan. Pada tanggal 17 Desember 2010, berdasarkan akta perubahan perjanjian kredit yang diaktakan dalam akta No. 70 dengan Notaris yang sama, Perusahaan mendapatkan tambahan fasilitas kredit sebesar Rp 35.000.000.000, sehingga jumlah plafond yang diberikan Bukopin menjadi Rp 75.000.000.000, dan akan jatuh tempo pada 26 Juli 2012, dengan suku bunga sebesar 11% per tahun. Pada tanggal 31 Desember 2011 , saldo pinjaman fasilitas ini adalah sebesar Rp 74.833.250.161 (2010: Rp 74.762.456.757).

i. Based on Credit Agreement No. 28 made before Dr. Tetty Herawati Soebroto, SH, MH, a Notary in Jakarta, dated 26 July 2010, the Company obtained an credit facility from PT Bank Bukopin Tbk (Bukopin) with maximum credit limit amounted to Rp 40,000,000,000 which is used for working capital operations. On 17 December 2010,according to deed of amendment of credit agreement No.70 made by the same Notary, the Company obtained additional credit facilities amounting to Rp 35,000,000,000, so the maximum credit facility provided by Bukopin is amounted to Rp 75,000,000,000, and will mature on 26 July 2017 which bear interest at 11% annually.As of 31 December 2011, outstanding balance of this facility was Rp 74,833,250,161 (2010: Rp 74,762,456,757).

Fasilitas pinjaman yang diperoleh dari Bukopin dijamin dengan jaminan:

Credit facility that obtained from Bank Bukopin was secured by:

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/61 Exhibit E/61

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

23. UTANG BANK JANGKA PANJANG (Lanjutan) 23. LONG-TERM BANK LOANS (Continued)

b. PT Bank Bukopin Tbk (Lanjutan) b. PT Bank Bukopin Tbk (Continued)

2 (dua) bidang tanah dan bangunan yang terletak di Desa Agrapura, Kecamatan Cigudeg, Kabupaten Bogor, Propinsi Jawa Barat dengan SHGB No. 5 seluas 72.460 m2 dan SHGB No. 6 seluas 79.000 m2 yang tercatat atas nama Perusahaan;

2 (two) land lot and building in Argapura Village, Cigudeg District, Bogor Regency, West Jabar Province, with SHGB No. 5 of 72.460 sqm and SHGB No.6 79.000 sqm registered with the name of the Company;

3 Bidang tanah dengan SHGB No.1 seluas 95.725

m2, SHGB No. 2 seluas 76.945 m2 dan SHGB No. 5 seluas 62.395 yang terletak di Desa Cijulang, Kecamatan Jampang Tengah, Kabupaten Sukabumi, Propinsi Jawa Barat yang terdaftar atas nama Perusahaan.

3 land lot with an area of 95,725 sqm with SHGB No.1, area of 76,945 sqm with SHGB No. 2 and area of 62,395 sqm with SHGBNo. 3 located in the Cijulang Village, Middle Jampang District, Sukabumi Regency, West Java Province, which are registered under the name of the Company.

3 Bidang tanah dengan SHGB No.1 seluas 43.180

m2, SHGB No. 2 seluas 88.690 m2 dan SHGB No. 10 seluas 43.180 m2 yang terletak di Desa Cijulang, Kecamatan Jampang Tengah, Kabupaten Sukabumi, Propinsi Jawa Barat yang terdaftar atas nama Perusahaan.

3 land lot with an area of 43,180 sqm with SHGB No.1, area of 88,690 sqm with SHGB No. 2 and area of 43,180 sqm with SHGB No. 10 located in the Cijulang Village, Middle Jampang District, Sukabumi Regency, West Java Province, which are registered under the name of the Company.

Mesin dan peralatan Breeding Farm dengan

total nilai penjaminan Rp 16.556.900.000. Machineries and equipment Breeding Farm

with collateral amount Rp 16,556,900,000.

ii. Berdasarkan Perjanjian Kredit No. 71 tanggal 5 April 2011 yang dinyatakan dalam akta Notaris Arry Supratno, SH, Notaris di Jakarta, Perusahaan memperoleh fasilitas line Letter of Credit (LC)/ Surat Kredit Berdokumen Dalam Negeri (SKBDN) dalam bentuk Sight LC dengan maksimum kredit sebesar USD 20,000,000 atau setara dengan Rp 180.000.000.000 dengan tujuan untuk pembelian bahan baku pakan ternak (impor dan lokal). Jangka waktu fasilitas LC/SKBDN adalah 24 bulan, sejak tanggal penandatanganan perjanjian kredit sampai dengan 5 April 2013 dan dikenakan bunga sebesar 5% per tahun jika dalam mata uang USD (Dollar Amerika Serikat) atau 11% per tahun jika dalam mata uang IDR (Indonesia Rupiah).

ii. Based on Credit Agreement No. 71 made before Arry Supratno, SH, a notary in Jakarta, dated 5 April 2011, the Company obtained Line Letter of Credit (LC) facility/Domestic Letter of Credit Documented (SKBDN) such as Sight LC with maximum credit of USD 20,000,000 or equivalent to Rp 180,000,000,000 with the purpose to purchase of feed raw material (import and local).LC facility period is 24 months, since date of signing the loan agreement up to 5 April 2013 and bears a floating interest rate of 5% annually if the currency in USD (U.S Dollar) or 11% annually ifthe currency in IDR (Indonesian Rupiah).

Atas fasilitas tersebut diatas, Perusahaan menambah agunan yang terdiri dari:

The above facility, the Company added collateral such as:

Persediaan bahan baku pakan ternak yang

dibiayai dengan fasilitas ini minimal 83.000 ton ekuivalen dengan Rp 250.000.000.000.

Inventory of feed raw material was financed with minimum facility of 83,000.ton equivalent with Rp 250,000,000,000.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/63 Exhibit E/63

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

23. UTANG BANK JANGKA PANJANG (Lanjutan) 23. LONG-TERM BANK LOANS (Continued)

c. PT Bank Mandiri (Persero) Tbk (Lanjutan) c. PT Bank Mandiri (Persero) Tbk (Continued)

Jaminan atas fasilitas ini terikat secara Cross Collateralized terhadap fasilitas kredit modal kerja dengan Perjanjian Kredit No. 198 yang diperoleh Perusahaan dari Bank Mandiri.

The collateral for this facility was "Cross Collateralized" against working capital loan facility under Letter of Agreement No. 198 obtained from Bank Mandiri.

Atas pinjaman ini, Perusahaan terikat dengan pembatasan tidak diperkenankan sama dengan yang ditetapkan pada fasilitas kredit investasidengan Perjanjian No. 198 tanggal 28 September 2010.

Under this agreement, the Company is bound to several covenants which are corresponding to the investment credit facility under Letter of Agreement No. 198 dated 28 September 2010.

ii. Berdasarkan Perjanjian Kredit Investasi No. 126

tanggal 28 September 2011, Perusahaan memperoleh tambahan fasilitas kredit investasi dari Bank Mandiri dengan maksimum kredit sampai dengan Rp 50.000.000.000 yang digunakan untuk investasi pembiayaan aset berupa rumah potong ayam yang terletak di Mojokerto, Jawa Timur.

ii. Based on investment loan agreement No. 126 dated 28 September 2011, the Company obtained additional investment credit facility from Bank Mandiri with maximum credit up to Rp 50,000,000,000 used to financing of investment assets such as slaughterhouse in Mojokerto, East Java.

Pinjaman ini dikenakan suku bunga sebesar 10,5% per tahun dengan jangka waktu pinjaman 5 tahun. Pada tanggal 31 Desember 2011, saldo pinjaman kredit investasi adalah sebesar Rp 48.658.979.330.

This loan bears a floating interest rate of 10.5% annually with period of credit 5 years. As of 31 December 2011, the outstanding balance of investment credit loan is Rp 48,658,979,330.

Fasilitas pinjaman yang diperoleh dari Bank Mandiri ini dijamin dengan jaminan: Aset tetap berupa tanah dan bangunan rumah potong ayam beserta sarana pelengkap dan mesin- mesin di kabupaten Mojokerto, Jawa Timur yang akan diikat Hak Tanggungan senilai Rp 64.000.000.000.

This credit facility that obtained from Bank Mandiri was secured by collateral: Fixed Asset such as land and buildings slaughterhouse and supplementary facilities and machinery in Mojokerto Regency, East Java are bounded under contract of Mortgage amounted to Rp 64,000,000,000.

Jaminan atas fasilitas ini terikat secara Cross Collateralized dan Cross Default dengan jaminan seluruh fasilitas kredit Perusahaan yang diperoleh dari Bank Mandiri.

The collateral for this facility was Cross Collateralized and Cross Default with total collateral credit facilitys Company which obtained from Bank Mandiri.

d. PT CIMB Niaga Tbk d. PT Bank CIMB Niaga Tbk

Berdasarkan Perjanjian Kredit No. 335/LGL/PK/NAT/VII/2010 tanggal 16 Agustus 2010, PT Sierad Industries (Entitas anak) memperoleh fasilitas kredit investasi dari PT Bank CIMB Niaga Tbk dengan maksimum kredit sampai dengan Rp 63.500.000.000 untuk keperluan pembelian Office Space gedung.Jangka waktu pinjaman adalah sejak penandatanganan perjanjian kredit sampai dengan 31 Desember 2019 dengan suku bunga sebesar 12% per tahun. Pada tanggal 31 Desember 2011, saldo pinjaman kredit investasi adalah sebesar Rp 25.400.000.000 (2010: Rp 25.229.847.864).

Based No. 335/LGL/PK/NAT/VII/2010 Credit Agreement dated 16 August 2010, PT Sierad Industries (The Subsidiary) obtained investment credit facility from PT Bank CIMB Niaga Tbk with a maximum credit up to Rp 63,500,000,000 to purchase Office Space building, the period of this loan is started from the signing date of this loan agreement until 31 December 2019 and charged annual interest at 12%. As of 31 December 2011, the outstanding balance of this Credit Investmentamounted to Rp 25,400,000,000 (2010: Rp 25,229,847,864).

Fasilitas pinjaman yang diperoleh dari PT Bank CIMB Niaga Tbk ini dijamin dengan jaminan:

Credit facility that obtained from PT Bank CIMB Niaga Tbk was secured by:

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/62 Exhibit E/62

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

23. UTANG BANK JANGKA PANJANG (Lanjutan) 23. LONG-TERM BANK LOANS (Continued)

b. PT Bank Bukopin Tbk (Lanjutan) b. PT Bank Bukopin Tbk (Continued)

Jaminan atas fasilitas ini terikat secara Cross Collateralized terhadap fasilitas kredit modal kerja dengan Perjanjian Kredit No. 28 tanggal 26 Juli 2010 dan akta perubahan Perjanjian Kredit No. 70 tanggal 17 Desember 2010 dari Bukopin (lihat Catatan 22).

The collateral for this facility was "Cross Collateralized" against working capital loan facility under Letter of Agreements No. 28 dated 26 Juli 2010 and changes Letter of Agreements No. 70 dated 17 December 2010 from Bukopin (See Notes 22).

Pada tanggal 31 Desember 2011, saldo pinjaman fasilitas ini adalah sebesar USD 16.314.432 atau setara dengan Rp 147.939.266.217.

As of 31 December 2011, outstanding balance of this facility was USD 16,314,432 or equivalent to Rp 147,939,266,217.

iii. Berdasarkan Surat Perjanjian Kredit

No.12446/DKM/XI/2011 tanggal 20 Desember 2011, PT Belfoods Indonesia (Entitas anak) mendapatkan fasilitas kredit modal kerja dengan maksimum kredit sebesar Rp 40.000.000.000 dengan tujuan untuk modal kerja Perusahaan. Jangka waktu fasilitas adalah 72 bulan dengan tingkat suku bunga sebesar 12% per tahun. Pada tanggal 31 Desember 2011 saldo pinjaman ini adalah sebesar Rp 22.000.000.000.

iii. Based on Credit Agreement No.12446/DKM/XI/2011 dated 20 December 2011, PT Belfoods Indonesia (The Subsidiary) obtain working capital credit facility with maximum credit of Rp 40,000,000,000 with the purpose for Companys working capital. The term of loan is 72 month with the interest rate of 12% annually. As of 31 December 2011 ther outstanding balance of this facility is Rp 22,000,000,000.

Fasilitas pinjaman yang diperoleh dari Bukopin dijamin dengan jaminan:

Credit facility that obtained from Bank Bukopin was secured by:

Sebidang tanah dan bangunan pabrik

PT Belfoods Indonesia dengan SHGBNo.1984/Sukamaju seluas 24.875 m2 yang terletak di Kelurahan Sukamaju, Kecamatan Jonggol, Kabupaten Bogor, Provinsi Jawa Barat, tercatat atas nama PT Belfoods Indonesia.

Land and factory building PT Belfoods Indonesia factory, with an area of 24,875 m2 with SHGB No.1984/Sukamaju located in the Village Sukamaju, Jonggol district, Bogor, West Java Province, registered with the name of PT Belfoods Indonesia.

Sebidang tanah dan bangunan kantor

dengan SHGB No.1021/Cilandak Barat seluas 99 m2 yang terletak di Kelurahan Cilandak Barat, Kecamatan Cilandak, Kotamadya Jakarta Selatan, DKI Jakarta, tercatat atas nama PT Belfoods Indonesia.

Land and office building with SHGB No.1021/Cilandak Barat with an area of 99 m2 located in Cilandak Barat, Cilandak District, Jakarta Selatan, DKI Jakarta, registered with the name of PT Belfoods Indonesia.

Mesin-mesin produksi dan perlengkapan

PT Belfoods Indonesia Machineries and Equipment of PT Belfoods

Indonesia.

c. PT Bank Mandiri (Persero) Tbk c. PT Bank Mandiri (Persero) Tbk

i. Berdasarkan Perjanjian Kredit No. 197 tanggal 28 September 2010 yang dinyatakan dalam akta Notaris Dr. Irawan Soerodjo, SH, MSi, Notaris di Jakarta, Perusahaan memperoleh tambahan fasilitas kredit investasi dari PT Bank Mandiri(Persero) Tbk dengan maksimum kredit sampai dengan Rp 75.000.000.000 yang digunakan untuk pembiayaan aset berupa Breeding Farm dan Commercial Farm. Jangka waktu pinjaman adalah 5 tahun, sejak tanggal penandatanganan perjanjian kredit sampai dengan 27 September 2015 dengan suku bunga sebesar 10,5% per tahun. Pada tanggal 31 Desember 2011, saldo pinjaman kredit investasi adalah sebesar Rp 66.954.097.819 (2010: Rp 74.271.546.814).

i. Based on Credit Agreement No. 197 made before Dr. lrawan Soerodjo, SH, MSi, a Notary in Jakarta, dated 28 September 2010, the Company obtained an additional investment credit facility from PT Bank Mandiri (Persero) Tbk with maximum credit limit amounting to Rp 75,000,000,000, which is used to finance asset for Breeding Farm and Commercial Farm. The period of the loan is 5 year starting from the signing date of agreement up to 27 September 2015 and bears interest 10,5% annually. As of 31 December 2011, outstanding loans for investment credit loans amounted to Rp 66,954,097,819 (2010: Rp 74,271,546,814).

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/63 Exhibit E/63

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

23. UTANG BANK JANGKA PANJANG (Lanjutan) 23. LONG-TERM BANK LOANS (Continued)

c. PT Bank Mandiri (Persero) Tbk (Lanjutan) c. PT Bank Mandiri (Persero) Tbk (Continued)

Jaminan atas fasilitas ini terikat secara Cross Collateralized terhadap fasilitas kredit modal kerja dengan Perjanjian Kredit No. 198 yang diperoleh Perusahaan dari Bank Mandiri.

The collateral for this facility was "Cross Collateralized" against working capital loan facility under Letter of Agreement No. 198 obtained from Bank Mandiri.

Atas pinjaman ini, Perusahaan terikat dengan pembatasan tidak diperkenankan sama dengan yang ditetapkan pada fasilitas kredit investasidengan Perjanjian No. 198 tanggal 28 September 2010.

Under this agreement, the Company is bound to several covenants which are corresponding to the investment credit facility under Letter of Agreement No. 198 dated 28 September 2010.

ii. Berdasarkan Perjanjian Kredit Investasi No. 126

tanggal 28 September 2011, Perusahaan memperoleh tambahan fasilitas kredit investasi dari Bank Mandiri dengan maksimum kredit sampai dengan Rp 50.000.000.000 yang digunakan untuk investasi pembiayaan aset berupa rumah potong ayam yang terletak di Mojokerto, Jawa Timur.

ii. Based on investment loan agreement No. 126 dated 28 September 2011, the Company obtained additional investment credit facility from Bank Mandiri with maximum credit up to Rp 50,000,000,000 used to financing of investment assets such as slaughterhouse in Mojokerto, East Java.

Pinjaman ini dikenakan suku bunga sebesar 10,5% per tahun dengan jangka waktu pinjaman 5 tahun. Pada tanggal 31 Desember 2011, saldo pinjaman kredit investasi adalah sebesar Rp 48.658.979.330.

This loan bears a floating interest rate of 10.5% annually with period of credit 5 years. As of 31 December 2011, the outstanding balance of investment credit loan is Rp 48,658,979,330.

Fasilitas pinjaman yang diperoleh dari Bank Mandiri ini dijamin dengan jaminan: Aset tetap berupa tanah dan bangunan rumah potong ayam beserta sarana pelengkap dan mesin- mesin di kabupaten Mojokerto, Jawa Timur yang akan diikat Hak Tanggungan senilai Rp 64.000.000.000.

This credit facility that obtained from Bank Mandiri was secured by collateral: Fixed Asset such as land and buildings slaughterhouse and supplementary facilities and machinery in Mojokerto Regency, East Java are bounded under contract of Mortgage amounted to Rp 64,000,000,000.

Jaminan atas fasilitas ini terikat secara Cross Collateralized dan Cross Default dengan jaminan seluruh fasilitas kredit Perusahaan yang diperoleh dari Bank Mandiri.

The collateral for this facility was Cross Collateralized and Cross Default with total collateral credit facilitys Company which obtained from Bank Mandiri.

d. PT CIMB Niaga Tbk d. PT Bank CIMB Niaga Tbk

Berdasarkan Perjanjian Kredit No. 335/LGL/PK/NAT/VII/2010 tanggal 16 Agustus 2010, PT Sierad Industries (Entitas anak) memperoleh fasilitas kredit investasi dari PT Bank CIMB Niaga Tbk dengan maksimum kredit sampai dengan Rp 63.500.000.000 untuk keperluan pembelian Office Space gedung.Jangka waktu pinjaman adalah sejak penandatanganan perjanjian kredit sampai dengan 31 Desember 2019 dengan suku bunga sebesar 12% per tahun. Pada tanggal 31 Desember 2011, saldo pinjaman kredit investasi adalah sebesar Rp 25.400.000.000 (2010: Rp 25.229.847.864).

Based No. 335/LGL/PK/NAT/VII/2010 Credit Agreement dated 16 August 2010, PT Sierad Industries (The Subsidiary) obtained investment credit facility from PT Bank CIMB Niaga Tbk with a maximum credit up to Rp 63,500,000,000 to purchase Office Space building, the period of this loan is started from the signing date of this loan agreement until 31 December 2019 and charged annual interest at 12%. As of 31 December 2011, the outstanding balance of this Credit Investmentamounted to Rp 25,400,000,000 (2010: Rp 25,229,847,864).

Fasilitas pinjaman yang diperoleh dari PT Bank CIMB Niaga Tbk ini dijamin dengan jaminan:

Credit facility that obtained from PT Bank CIMB Niaga Tbk was secured by:

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/65 Exhibit E/65

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

24. UTANG MURABAHAH (Lanjutan) 24. MURABAHAH PAYABLES (Continued)

Pada 31 Desember 2011 saldo utang murabahah atas akad ini adalah sebesar Rp 74.625.000.000 (2010: Rp 10.325.000.000)

As of 31 December 2011, outstanding balance of murabahah payable for this contract was Rp 74,625,000,000 (2010: Rp 10,325,000,000).

b. Berdasarkan akta perjanjian kredit No. 4 tanggal

2 September 2010, yang dinyatakan dalam akta Notaris Efran Yuniarto, SH, M.Kn, Notaris di Jakarta, Perusahaan memperoleh pembiayaan Al Musyarakah dan/atau Al Murabahah (Switchable all scheme) dari PT Bank Syariah Mandiri (BSM) dengan jumlah maksimum sebesar Rp 20.000.000.000 digunakan untuk modal kerja bisnis rumah potong ayam (RPA). Pinjaman ini dengan sistem pola bagi hasil dan ditentukan pada saat pencairan. Perjanjian Kredit ini mengalami perubahan berdasarkan akta Addendum I No. 24 tanggal 16 Juni 2011 berkaitan dengan penambahan nilai jaminan. Fasilitas ini berlaku selama 12 bulan dan pada tanggal 31 Desember 2011 saldo utang murabahah atas akad ini adalah sebesar Rp 10.208.333.333 (2010: Rp 20.650.000.000).

b. Based on Letter of Credit Agreement No.7 dated 17 February 2010 and No. 4 dated 2 September 2010 which stated in Notarial deed Efran Yuniarto, SH, M. Kn, Notary in Jakarta, the Company obtained financing Al Musyarakah and/or Al Murabahah (Switchable all Scheme) from PT Bank Syariah Mandiri (BSM) with a maximum amount of Rp 20,000,000,000 used for working capital business slaughteredhouse chickens (RPA). The loan is with a system of revenue sharing scheme and is determined at the time of disbursement. This loan agreement has changes based on Addendum deed I No. 24 dated 16 June 2011 related to additional amount collateral. This facility is valid for 12 months and as of 31 December 2011, outstanding balance of mudarabah payable for this contract wasRp 10,208,333,333 (2010: Rp 20,650,000,000).

c. Berdasarkan akta perjanjian kredit No. 5 tanggal

2 September 2010 yang dinyatakan dalam Akta Notaris Efran Yuniarto, SH, M.Kn, Notaris di Jakarta, Perusahaan memperoleh Al Murabahah dari PT Bank Syariah Mandiri (BSM) dengan jumlah maksimum sebesar Rp 14.000.000.000. BSM akan melakukanpembelian peralatan dan sarana penunjang Rumah Potong Ayam atas nama Perusahaan dan akan dijual kembali ke Perusahaan sebesar harga perolehan ditambah dengan keuntungan yang disepakati. Perjanjian Kredit ini mengalami perubahan berdasarkan akta Addendum I No. 18 tanggal 16 Juni 2011 berkaitan dengan penambahan nilai jaminan. Fasilitas ini berlaku selama 60 bulan dan pada tanggal 31 Desember 2011, saldo utang murabahah atas akad ini adalah sebesar Rp 12.162.033.815 (2010: Rp 10.374.314.237).

c. Based on Letter of Credit Agreement No.7 dated 17 February 2010 and No. 4 dated 2 September 2010 which stated in Notarial deed Efran Yuniarto, SH, M.Kn, Notary in Jakarta, the Company obtained financing Al Murabahah from PT Bank Syariah Mandiri (BSM) with a maximum amount of Rp 14,000,000,000. BSM will purchase Slaughterhouse equipment and supporting facilities on behalf of the Company and sell to the Company at cost plus agreed profit. This loan agreement has changes based on Addendum deed I No. 18 dated 16 June 2011 related to additional amount collateral. This facility is valid for 60 months and as of 31 December 2011, outstanding balance of mudarabah payable for this contract wasRp 12,162,033,815 (2010: Rp 10,374,314,237).

d. Berdasarkan akta perjanjian kredit No. 6 tanggal

2 September 2010 yang dinyatakan dalam akta Notaris Efran Yuniarto, SH, M.Kn, Notaris di Jakarta, Perusahaan memperoleh pembiayaan Al Murabahah dari PT Bank Syariah Mandiri (BSM) dengan jumlah maksimum sebesar Rp 50.000.000.000. BSM akan melakukan pembelian mesin dan peralatan outlet penjualan ayam potong Belmart atas nama Perusahaan dan akan dijual kembali ke Perusahaan sebesar harga perolehan ditambah dengan keuntungan yang disepakati. Perjanjian Kredit ini mengalami perubahan berdasarkan akta Addendum I No. 19 tanggal 16 Juni 2011 berkaitan dengan penambahan nilai jaminan. Fasilitas ini berlaku selama 60 bulan dan pada tanggal 31 Desember 2011saldo utang murabahah atas akad ini adalah sebesar Rp47.325.171.410 (2010: Rp 35.975.941.379).

d. Based on Letter of Credit Agreement No.6 dated 17 February 2010 and No. 4 dated 2 September 2010 which stated in Notarial deed Efran Yuniarto, SH, M. Kn, Notary in Jakarta, the Company obtained financing Al Murabahah from PT Bank Syariah Mandiri (BSM) with a maximum amount of Rp 50,000,000,000. BSM will purchase machineries and equipment for Bellmart outlet on behalf of the Company and sell to the Company at cost plus mark up price. This loan agreement has changes based on Addendum deed I No. 18 dated 16 June 2011 related to additional amount collateral. This facility is valid for 60 months and as of 31 December 2011, outstanding balance of mudarabah payable for this contract is Rp 47,325,171,410 (2010: Rp 35,975,941,379).

Beban Murabahah Ditangguhkan disajikan sebagai pengurang (contra account) Utang Murabahah.

Murabahah deferred margin expense is presented as a deduction (contra account) of Murabahah Payable.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/64 Exhibit E/64

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

23. UTANG BANK JANGKA PANJANG (Lanjutan) 23. LONG-TERM BANK LOANS (Continued)

d. PT CIMB Niaga Tbk (Lanjutan) e. PT Bank CIMB Niaga Tbk (Continued)

Office Space pada The City Center Tower 1, Lantai 7, Jl KH Mas Mansyur, Jakarta, yang di peroleh Perusahaan berdasarkan Perjanjian Pengikatan Jual Beli No.003/PPJB-TCC/GS/X/2009 tertanggal 20 Nopember 2009;

Office Space in The City Center Tower 1, 7th

floor, Jl KH Mas Mansyur, Jakarta which was acquired by purchase agreement No. 003/ PPJB-TCC/GS/X/2009 dated 20 November 2009;

Corporate Guarantee dari PT Sierad Produce Tbk

sebesar jumlah fasilitas kredit; Corporate Guarantee from PT Sierad Produce

Tbk amounting to total credit facilities

Buy Back Guarantee atas Office Space pada The City Center Tower 1, Lantai 7, KH Mas Mansyur, Jakarta dari PT Greenwood Sejahtera.

Buy Back Guarantee on Office Space in The City Center Tower 1, 7th Floor, KH Mas Mansyur, Jakarta from Greenwood PT Sejahtera.

24. UTANG MURABAHAH 24. MURABAHAH PAYABLES

2 0 1 1 2 0 1 0 PT Bank Syariah Mandiri PT Bank Syariah MandiriUtang jangka pendek 84.833.333.333 30.975.000.000 Short-term loanBeban murabahah tangguhan ( 1.833.333.333 ) ( 975.000.000) Deferred murabahah expenses Jumlah utang murabahah

jangka pendek 83.000.000.000 30.000.000.000 Total short-term murabahah payables

Utang jangka panjang 59.487.205.225 46.350.255.616 Long-term loanBeban murabahah tangguhan ( 18.489.123.135) ( 17.309.621.696) Deferred murabahah expenses

Jumlah utang murabahah Total long-term murabahah payables

jangka panjang 40.998.082.090 29.040.633.920

Dikurangi : bagian yang jatuh tempo dalam satu tahun ( 7.370.172.720 ) ( 4.299.223.278) Less : current maturities

Bagian jangka panjang 33.627.909.370 24.741.410.642 Long-term portion

a. Berdasarkan akta perjanjian kredit No. 7 tanggal

17 Pebruari 2010 yang dinyatakan dalam akta Notaris Efran Yuniarto, SH, M.Kn, Notaris di Jakarta, Perusahaan memperoleh pembiayaan Al Musyarakah dan/atau Al Murabahah (Switchable all scheme) dari PT Bank Syariah Mandiri (BSM) dengan jumlah maksimum sebesar Rp 40.000.000.000. Bank BSM akan melakukan pembelian komoditi jagung atas nama Perusahaan dan akan dijual kembali ke Perusahaan sebesar harga perolehan ditambah dengan keuntungan yang disepakati.

a. Based on Letter of Credit Agreement No.7 dated 17 February 2010 and No. 4 dated 2 September 2010 which stated in Notarial deed Efran Yuniarto, SH, M. Kn, Notary in Jakarta, the Company obtained financing Al Musyarakah and/or Al Murabahah (Switchable all Scheme) from PT Bank Syariah Mandiri (BSM) with a maximum amount of Rp 40,000,000,000. BSM will purchase Corn commodity on behalf of the Company and sell to the Company at cost plus agreed profit.

Berdasarkan akta Addendum I No. 16 dan Addendum II No. 17 tanggal 16 Juni 2011, fasilitas tersebut diatas telah diperpanjang untuk jangka waktu 12 bulan dan terdapat perubahan tujuan pembiayaan yaitu menjadi modal kerja pabrik pakan ternak sebesar Rp 40.000.000.000. Disamping itu, Perusahaan memperoleh tambahan pembiayaan modal kerja untuk pabrik pakan ternak sebesar Rp 100.000.000.000 sehingga total menjadi Rp 140.000.000.000.

Based on Addendum deed I No. 16 and Addendum II No. 17 dated 16 June 2011, the facility has extended for period 12 month and there are changes purpose of financing for working capital feed factory amount of Rp 40,000,000,000. Beside that, the Company obtained addition financing working capital for feed factory amount of Rp 100,000,000,000 that totally Rp 140,000,000,000.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/65 Exhibit E/65

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

24. UTANG MURABAHAH (Lanjutan) 24. MURABAHAH PAYABLES (Continued)

Pada 31 Desember 2011 saldo utang murabahah atas akad ini adalah sebesar Rp 74.625.000.000 (2010: Rp 10.325.000.000)

As of 31 December 2011, outstanding balance of murabahah payable for this contract was Rp 74,625,000,000 (2010: Rp 10,325,000,000).

b. Berdasarkan akta perjanjian kredit No. 4 tanggal

2 September 2010, yang dinyatakan dalam akta Notaris Efran Yuniarto, SH, M.Kn, Notaris di Jakarta, Perusahaan memperoleh pembiayaan Al Musyarakah dan/atau Al Murabahah (Switchable all scheme) dari PT Bank Syariah Mandiri (BSM) dengan jumlah maksimum sebesar Rp 20.000.000.000 digunakan untuk modal kerja bisnis rumah potong ayam (RPA). Pinjaman ini dengan sistem pola bagi hasil dan ditentukan pada saat pencairan. Perjanjian Kredit ini mengalami perubahan berdasarkan akta Addendum I No. 24 tanggal 16 Juni 2011 berkaitan dengan penambahan nilai jaminan. Fasilitas ini berlaku selama 12 bulan dan pada tanggal 31 Desember 2011 saldo utang murabahah atas akad ini adalah sebesar Rp 10.208.333.333 (2010: Rp 20.650.000.000).

b. Based on Letter of Credit Agreement No.7 dated 17 February 2010 and No. 4 dated 2 September 2010 which stated in Notarial deed Efran Yuniarto, SH, M. Kn, Notary in Jakarta, the Company obtained financing Al Musyarakah and/or Al Murabahah (Switchable all Scheme) from PT Bank Syariah Mandiri (BSM) with a maximum amount of Rp 20,000,000,000 used for working capital business slaughteredhouse chickens (RPA). The loan is with a system of revenue sharing scheme and is determined at the time of disbursement. This loan agreement has changes based on Addendum deed I No. 24 dated 16 June 2011 related to additional amount collateral. This facility is valid for 12 months and as of 31 December 2011, outstanding balance of mudarabah payable for this contract wasRp 10,208,333,333 (2010: Rp 20,650,000,000).

c. Berdasarkan akta perjanjian kredit No. 5 tanggal

2 September 2010 yang dinyatakan dalam Akta Notaris Efran Yuniarto, SH, M.Kn, Notaris di Jakarta, Perusahaan memperoleh Al Murabahah dari PT Bank Syariah Mandiri (BSM) dengan jumlah maksimum sebesar Rp 14.000.000.000. BSM akan melakukanpembelian peralatan dan sarana penunjang Rumah Potong Ayam atas nama Perusahaan dan akan dijual kembali ke Perusahaan sebesar harga perolehan ditambah dengan keuntungan yang disepakati. Perjanjian Kredit ini mengalami perubahan berdasarkan akta Addendum I No. 18 tanggal 16 Juni 2011 berkaitan dengan penambahan nilai jaminan. Fasilitas ini berlaku selama 60 bulan dan pada tanggal 31 Desember 2011, saldo utang murabahah atas akad ini adalah sebesar Rp 12.162.033.815 (2010: Rp 10.374.314.237).

c. Based on Letter of Credit Agreement No.7 dated 17 February 2010 and No. 4 dated 2 September 2010 which stated in Notarial deed Efran Yuniarto, SH, M.Kn, Notary in Jakarta, the Company obtained financing Al Murabahah from PT Bank Syariah Mandiri (BSM) with a maximum amount of Rp 14,000,000,000. BSM will purchase Slaughterhouse equipment and supporting facilities on behalf of the Company and sell to the Company at cost plus agreed profit. This loan agreement has changes based on Addendum deed I No. 18 dated 16 June 2011 related to additional amount collateral. This facility is valid for 60 months and as of 31 December 2011, outstanding balance of mudarabah payable for this contract wasRp 12,162,033,815 (2010: Rp 10,374,314,237).

d. Berdasarkan akta perjanjian kredit No. 6 tanggal

2 September 2010 yang dinyatakan dalam akta Notaris Efran Yuniarto, SH, M.Kn, Notaris di Jakarta, Perusahaan memperoleh pembiayaan Al Murabahah dari PT Bank Syariah Mandiri (BSM) dengan jumlah maksimum sebesar Rp 50.000.000.000. BSM akan melakukan pembelian mesin dan peralatan outlet penjualan ayam potong Belmart atas nama Perusahaan dan akan dijual kembali ke Perusahaan sebesar harga perolehan ditambah dengan keuntungan yang disepakati. Perjanjian Kredit ini mengalami perubahan berdasarkan akta Addendum I No. 19 tanggal 16 Juni 2011 berkaitan dengan penambahan nilai jaminan. Fasilitas ini berlaku selama 60 bulan dan pada tanggal 31 Desember 2011saldo utang murabahah atas akad ini adalah sebesar Rp47.325.171.410 (2010: Rp 35.975.941.379).

d. Based on Letter of Credit Agreement No.6 dated 17 February 2010 and No. 4 dated 2 September 2010 which stated in Notarial deed Efran Yuniarto, SH, M. Kn, Notary in Jakarta, the Company obtained financing Al Murabahah from PT Bank Syariah Mandiri (BSM) with a maximum amount of Rp 50,000,000,000. BSM will purchase machineries and equipment for Bellmart outlet on behalf of the Company and sell to the Company at cost plus mark up price. This loan agreement has changes based on Addendum deed I No. 18 dated 16 June 2011 related to additional amount collateral. This facility is valid for 60 months and as of 31 December 2011, outstanding balance of mudarabah payable for this contract is Rp 47,325,171,410 (2010: Rp 35,975,941,379).

Beban Murabahah Ditangguhkan disajikan sebagai pengurang (contra account) Utang Murabahah.

Murabahah deferred margin expense is presented as a deduction (contra account) of Murabahah Payable.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/67 Exhibit E/67

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

25. UTANG SEWA PEMBIAYAAN 25. FINANCE LEASE PAYABLE

Perusahaan Jenis Type of Sewa Pembiayaan Aset 2011 2010 Assets Lessor PT BCA Finance Kendaraan 1.244.777.775 2.847.350.498 Vehicle PT BCA FinancePT Orix Indonesia Finance Kendaraan 95.857.928 587.860.200 Vehicle PT Orix Indonesia FinancePT Dipostar Finance Kendaraan - 43.956.100 Vehicle PT Dipostar Finance 1.340.635.703 3.479.166.798 Dikurangi: Bagian yang

jatuh tempo dalam satu Tahun ( 909.435.703 )( 2.094.693.120) Less : Current maturities

Bagian Jangka Panjang 431.200.000 1.384.473.678 Long-Term Portion

Utang sewa pembiayaan ini dijamin dengan aset sewa pembiayaan yang bersangkutan.

Finance lease payable is secured by the respective leased assets.

Pembayaran sewa minimum masa datang (future minimum lease payment), bagian bunga dan nilai tunai dari jumlah angsuran sewa pembiayaan per 31 Desember 2011 dan 2010 adalah sebagai berikut:

Future minimum lease payment in lease agreement, interest and cash value from amount of installment finance lease as of 31 December 2011 and 2010 is as follows:

31 Desember 2011/ 31 December 2011 Pembayaran

Sewa Minimum/ Minimum Lease

Payment Rp

Bunga/ Interest Rp

Jumlah

Angsuran/ Amount of

Installments Rp

Nilai Tunai/ Cash Value

Rp Tahun 2012 909.435.703 204.042.646 1.113.478.349 1.641.256.326 Year 2012Tahun 2013 409.200.000 97.099.200 506.299.200 1.018.357.183 Year 2013Tahun 2014 22.000.000 5.280.000 27.280.000 66.788.854 Year 2014 1.340.635.703 306.421.846 1.647.057.549 2.726.402.363

31 Desember 2010/ 31 December 2010 Pembayaran

Sewa Minimum/ Minimum Lease

Payment Rp

Bunga/ Interest Rp

Jumlah

Angsuran/ Amount of

Installments Rp

Nilai Tunai/ Cash Value

Rp Tahun 2011 2.094.693.120 502.897.338 2.597.590.458 2.597.590.458 Year 2011Tahun 2012 953.273.678 254.311.358 1.207.585.036 1.779.968.689 Year 2012Tahun 2013 409.200.000 97.099.200 506.299.200 1.018.357.183 Year 2013Tahun 2014 22.000.000 5.280.000 27.280.000 66.788.854 Year 2014 3.479.166.798 859.587.896 4.338.754.694 5.462.705.184

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/66 Exhibit E/66

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

24. UTANG MURABAHAH (Lanjutan) 24. MURABAHAH PAYABLES (Continued)

Fasilitas pinjaman yang diperoleh dari BSM dijamin dengan jaminan:

Credit facilities that are obtained from BSM was secured by:

Sebidang tanah yang terletak di Desa

Sukanegara, Kecamatan Tanjung Bintang, Kabupaten Lampung Selatan, Propinsi Lampung dengan SHGB No. 196 atas nama Perusahaan yang diikat dengan nilai pertanggungan sebesar Rp 38.000.000.000;

A land lot in Sukanegara Village, Tanjung Bintang District, South Lampung Regency, Lampung Province, with SHGB No. 196 under the name of the Company which bound under contract of First Class Mortgage amountRp 38,000,000,000;

8 bidang tanah dan bangunan yang terletak di

Desa Cikujang, Kecamatan Cisaat, Kabupaten Sukabumi, Propinsi Jawa Barat yang saat ini dalam proses penerbitan sertifikat tanda bukti hak tanah ke atas nama Perusahaan dengan nilai pertanggungan Rp 13.000.000.000;

8 (eight) land lot and building in Cikujang Village, Cisaat District, Sukabumi Regency, West Java Province, which are currently in the process of issuance of certificates of proof of land rights to the name of the Company which bound First Class Mortgage amounted to Rp 13,000,000,000;

2 bidang tanah dan bangunan yang terletak di

Desa Mlangsen, Kecamatan Blora, Kabupaten Blora, Propinsi Jawa Tengah dengan SHGB No. 380 dan No. 381 atas nama Perusahaan dengan nilai pertanggungan Rp 700.000.000;

2 land lot and building in Mlangsen Village, Blora District, Blora Regency, Central Java Province with SHGB No.380 and SHGB No. 381 the name of the Company which bound First Class Mortgage amounted to Rp 700,000,000;

Mesin-mesin pabrik yang terletak di Desa

Sukanegara, Kecamatan Tanjung Bintang, Kabupaten Lampung Selatan, Propinsi Lampung dengan nilai jaminan sebesar Rp 10.000.000.000;

Machineries which are located in the SukanegaraVillage, Tanjung Bintang District, South Lampung Regency, Lampung Province with Collateral Value of Rp 10,000,000,000;

Mesin-mesin pabrik, outlet dan peralatan diikat

fidusia dengan nilai penjaminanRp 36.000.000.000;

Factory machineries, outlet and equipment are under fiduciary with collateral amounted to Rp 36,000,000,000;

Persediaan diikat dengan fidusia dengan nilai

penjaminan Rp 6.000.000.000; dan Inventory is under fiduciary with collateral

amounted to Rp 6,000,000,000; and

Piutang Dagang diikat fidusia dengan nilai penjaminan Rp 168.000.000.000.

Trade receivable is under fiduciary with collateral amounted Rp 168,000,000,000;

Fasilitas tersebut mensyaratkan antara lain Perusahaan tidak diperkenankan untuk:

This credit facility requires that the Company shall not to:

Mengubah anggaran dasar kecuali, susunan

pengurus dan struktur modal; Change the articles of association except, board

of management and capital structure; Membagikan dividen kepada pemegang saham; Distribute dividend to shareholders; Mengeluarkan pernyataan berutang dalam

bentuk pinjaman, penyewaan atau garansi kepada pihak lain;

Release the statement owes in loans, leasing or guarantee to another party;

Meminta pembiayaan baru atau tambahan dari bank atau lembaga keuangan pembiayaan lainnya untuk proyek yang sama;

Request new or additional financing from banks or other financial institution to finance the same project;

Melakukan merger dengan perusahaan lain; Merged with another company; Melakukan penjualan atau mengalihkan

kepemilikan minimal Rp 1 milyar aset Perusahaan; dan

Conduct the sale or transfer of ownership of the assets of the Company minimum Rp 1 billion ; and

Menjaminkan, menjual atau membebani dengan liabilitas atas aset yang menjadi jaminan bank.

Pledge, sell or charge with the liability of the assets that pledged as bank collateral.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/67 Exhibit E/67

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

25. UTANG SEWA PEMBIAYAAN 25. FINANCE LEASE PAYABLE

Perusahaan Jenis Type of Sewa Pembiayaan Aset 2011 2010 Assets Lessor PT BCA Finance Kendaraan 1.244.777.775 2.847.350.498 Vehicle PT BCA FinancePT Orix Indonesia Finance Kendaraan 95.857.928 587.860.200 Vehicle PT Orix Indonesia FinancePT Dipostar Finance Kendaraan - 43.956.100 Vehicle PT Dipostar Finance 1.340.635.703 3.479.166.798 Dikurangi: Bagian yang

jatuh tempo dalam satu Tahun ( 909.435.703 )( 2.094.693.120) Less : Current maturities

Bagian Jangka Panjang 431.200.000 1.384.473.678 Long-Term Portion

Utang sewa pembiayaan ini dijamin dengan aset sewa pembiayaan yang bersangkutan.

Finance lease payable is secured by the respective leased assets.

Pembayaran sewa minimum masa datang (future minimum lease payment), bagian bunga dan nilai tunai dari jumlah angsuran sewa pembiayaan per 31 Desember 2011 dan 2010 adalah sebagai berikut:

Future minimum lease payment in lease agreement, interest and cash value from amount of installment finance lease as of 31 December 2011 and 2010 is as follows:

31 Desember 2011/ 31 December 2011 Pembayaran

Sewa Minimum/ Minimum Lease

Payment Rp

Bunga/ Interest Rp

Jumlah

Angsuran/ Amount of

Installments Rp

Nilai Tunai/ Cash Value

Rp Tahun 2012 909.435.703 204.042.646 1.113.478.349 1.641.256.326 Year 2012Tahun 2013 409.200.000 97.099.200 506.299.200 1.018.357.183 Year 2013Tahun 2014 22.000.000 5.280.000 27.280.000 66.788.854 Year 2014 1.340.635.703 306.421.846 1.647.057.549 2.726.402.363

31 Desember 2010/ 31 December 2010 Pembayaran

Sewa Minimum/ Minimum Lease

Payment Rp

Bunga/ Interest Rp

Jumlah

Angsuran/ Amount of

Installments Rp

Nilai Tunai/ Cash Value

Rp Tahun 2011 2.094.693.120 502.897.338 2.597.590.458 2.597.590.458 Year 2011Tahun 2012 953.273.678 254.311.358 1.207.585.036 1.779.968.689 Year 2012Tahun 2013 409.200.000 97.099.200 506.299.200 1.018.357.183 Year 2013Tahun 2014 22.000.000 5.280.000 27.280.000 66.788.854 Year 2014 3.479.166.798 859.587.896 4.338.754.694 5.462.705.184

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/69 Exhibit E/69

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

26. LIABILITAS IMBALAN KERJA (Lanjutan) 26. PROVISION FOR EMPLOYEE BENEFITS (Continued)

Asumsi utama yang digunakan dalam menentukan biaya manfaat pensiun oleh PT Padma Radya Aktuaria, aktuaris independen masing-masing pada tanggal 31 Desember 2011 dan 2010, adalah sebagai berikut:

The main assumptions used in determination of employee benefits by PT Padma Radya Aktuaria, an independent actuary in 31 December 2011 and 2010 areas follows:

2011 2010 Usia Pensiun Normal : 60 60 : Normal Retirement Age Tingkat Diskonto : 7% per tahun/ annum 9% per tahun/ annum : Discount Rate Tingkat Proyeksi Kenaikan Gaji : 10% per tahun/ annum 10% per tahun/ annum : Projected Salary Increase Rate Tingkat Cacat : 5% tingkat mortalita/per

mortality rate 5% tingkat mortalita/per

mortality rate : Disability Rate

Tingkat Pengunduran Diri : 6% untuk usia 30 tahun dan menurun secara linear

sebesar 0% pada usia 52 tahun/6% for the age 30

years and decrease 0% for the age 52 years

6% untuk usia 30 tahun dan menurun secara linear

sebesar 0% pada usia 52 tahun/6% for the age 30

years and decrease 0% for the age 52 years

: Resignation Rate

Tingkat Mortalita : 100% TMMI 100% TMMI : Mortality RateMetode : Projected Unit Credit Projected Unit Credit : Method

27. MODAL SAHAM 27. SHARE CAPITAL

Pemegang saham Perusahaan per 31 Desember 2011 dan 2010 berdasarkan jenis saham adalah sebagai berikut:

The Companys shareholders based on series of shares as of 31 December 2011 and 2010 are as follows:

31 Desember 2010 and 2011/

31 December 2010 dan 2011

Jumlah saham/ Nilai nominal lama/ Jumlah/ Total shares Old par value Total (Lembar/shares) (Rp) (Rp) Pemegang Saham Shareholders Seri A 73.099.900 395 28.874.460.500 A SeriesSeri B 650.686.609 395 257.021.210.555 B SeriesSeri C 8.667.321.984 100 866.732.198.400 C Series Jumlah 9.391.108.493 1.152.627.869.455 T o t a l

Saham seri A, B dan C adalah saham biasa atas nama yang memiliki hak yang sama.

Shares of A, B and C series are common stock under name which entitles the same right.

Susunan pemegang saham Perusahaan perper 31 Desember 2011 dan 2010 dengan jumlah kepemilikan saham diatas 5% adalah sebagai berikut:

The Company's shareholders as of 31 December 2011and 2010 with the percentage of ownership above 5% are as follows:

Jumlah saham/ Jumlah/ Total shares Total (Lembar/Shares) (%) Pemegang Saham Shareholders Jade Field Assets Limited 1.461.657.441 15,56 Jade Field Assets LimitedHarvest Agents Limited 1.345.766.034 14,33 Harvest Agents LimitedKingdom Industrial Limited 1.064.706.380 11,34 Kingdom Industrial LimitedPT Sietek Nusantara Finance 20.018.500 0,21 PT Sietek Nusantara FinanceMasyarakat (masing-masing dengan

kepemilikan kurang dari 5%) 5.498.960.138 58,56 Public (each below 5% of ownership) Jumlah 9.391.108.493 100,00 Total

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/68 Exhibit E/68

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

26. LIABILITAS IMBALAN KERJA 26. PROVISION FOR EMPLOYEE BENEFITS

Perusahaan telah menghitung liabilitasnya sehubungan dengan Undang-undang Ketenagakerjaan No. 13 tahun 2003. Tidak ada pendanaan yang dilakukan sehubungan dengan program manfaat karyawan tersebut.

The Company has determined the provision for employee benefits according to the Labor Law No.13/2003. There are no separate funding provided for these benefits

Saldo liabilitas program manfaat karyawan pada tahun 2011 dan 2010 merupakan hasil perhitungan aktuaria sesuai dengan penerapan PSAK 24 (Revisi 2004) mengenai Imbalan Kerja.

The balances of post employment benefits liabilities in 2011 and 2010 are based on actuary calculation as required by PSAK 24 (Revised 2004) regarding "Employee Benefits".

Jumlah yang dimasukkan ke dalam laporan posisi keuangan konsolidasian yang timbul dari kewajiban Grup terhadap provisi manfaat karyawan adalah sebagai berikut:

The amounts included in the consolidated statement of financial position arising from the Groups obligation on provision for employee benefits are as follows:

2 0 1 1 2 0 1 0 Nilai kini kewajiban jasa lalu 82.317.597.837 49.892.798.256 Present value past service liability Biaya jasa lalu yang belum diakui (non-

vested benefit) ( 53.180.180

)

( 125.087.265

)

Unrecognized past service cost (non-vested benefit)

Kerugian actuarial yang belum diakui ( 31.816.107.951 ) ( 20.912.034.913 ) Unrecognized actuarial loss Liabilitas bersih 50.448.309.706 28.855.676.078 Net liability

Beban manfaat karyawan pada tahun/periode berjalan adalah sebagai berikut :

Employee benefits expenses in current year are as follows:

2 0 1 1 2 0 1 0 Beban jasa kini 8.620.158.956 4.818.640.371 Current service costBeban bunga 4.723.099.201 3.665.802.236 Interest costBiaya jasa masa lalu (vested) - - Past service cost - (vested)Amortisasi biaya jasa masa lalu Amortization of past service cost -

(Non vested) 69.516.160 91.405.455 Non vested Efek penurunan - ( 3.684.989.324) Effect of curtailmentAmortisasi laba aktuaria 980.544.809 445.686.085 Amortization actuarial gain (loss)Mutasi bersih 287.104.450 33.385.588 Movement net Jumlah beban manfaat karyawan 14.680.423.576 5.369.930.411 Total employee benefits expenses

Perubahan pada liabilitas yang diakui di neracakonsolidasian:

Changes of liabilities recognized in consolidated balance sheets:

2 0 1 1 2 0 1 0 Liabilitas awal tahun 28.855.676.078 24.176.107.213 Liabilities - Beginning of yearEntitas anak yang diakuisisi 8.795.854.878 - Acquired subsidiariesPembayaran manfaat karyawan Employee benefits

Selama tahun berjalan ( 1.883.644.825) ( 690.361.546) payment in current year Beban manfaat karyawan yang diakui Recognized employee benefits expenses

pada tahun berjalan 14.680.423.575 5.369.930.411 in current year Penyesuaian/koreksi - - Adjustment/correction Liabilitas Akhir Tahun 50.448.309.706 28.855.676.078 Liabilities at the end of the Year

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/69 Exhibit E/69

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

26. LIABILITAS IMBALAN KERJA (Lanjutan) 26. PROVISION FOR EMPLOYEE BENEFITS (Continued)

Asumsi utama yang digunakan dalam menentukan biaya manfaat pensiun oleh PT Padma Radya Aktuaria, aktuaris independen masing-masing pada tanggal 31 Desember 2011 dan 2010, adalah sebagai berikut:

The main assumptions used in determination of employee benefits by PT Padma Radya Aktuaria, an independent actuary in 31 December 2011 and 2010 areas follows:

2011 2010 Usia Pensiun Normal : 60 60 : Normal Retirement Age Tingkat Diskonto : 7% per tahun/ annum 9% per tahun/ annum : Discount Rate Tingkat Proyeksi Kenaikan Gaji : 10% per tahun/ annum 10% per tahun/ annum : Projected Salary Increase Rate Tingkat Cacat : 5% tingkat mortalita/per

mortality rate 5% tingkat mortalita/per

mortality rate : Disability Rate

Tingkat Pengunduran Diri : 6% untuk usia 30 tahun dan menurun secara linear

sebesar 0% pada usia 52 tahun/6% for the age 30

years and decrease 0% for the age 52 years

6% untuk usia 30 tahun dan menurun secara linear

sebesar 0% pada usia 52 tahun/6% for the age 30

years and decrease 0% for the age 52 years

: Resignation Rate

Tingkat Mortalita : 100% TMMI 100% TMMI : Mortality RateMetode : Projected Unit Credit Projected Unit Credit : Method

27. MODAL SAHAM 27. SHARE CAPITAL

Pemegang saham Perusahaan per 31 Desember 2011 dan 2010 berdasarkan jenis saham adalah sebagai berikut:

The Companys shareholders based on series of shares as of 31 December 2011 and 2010 are as follows:

31 Desember 2010 and 2011/

31 December 2010 dan 2011

Jumlah saham/ Nilai nominal lama/ Jumlah/ Total shares Old par value Total (Lembar/shares) (Rp) (Rp) Pemegang Saham Shareholders Seri A 73.099.900 395 28.874.460.500 A SeriesSeri B 650.686.609 395 257.021.210.555 B SeriesSeri C 8.667.321.984 100 866.732.198.400 C Series Jumlah 9.391.108.493 1.152.627.869.455 T o t a l

Saham seri A, B dan C adalah saham biasa atas nama yang memiliki hak yang sama.

Shares of A, B and C series are common stock under name which entitles the same right.

Susunan pemegang saham Perusahaan perper 31 Desember 2011 dan 2010 dengan jumlah kepemilikan saham diatas 5% adalah sebagai berikut:

The Company's shareholders as of 31 December 2011and 2010 with the percentage of ownership above 5% are as follows:

Jumlah saham/ Jumlah/ Total shares Total (Lembar/Shares) (%) Pemegang Saham Shareholders Jade Field Assets Limited 1.461.657.441 15,56 Jade Field Assets LimitedHarvest Agents Limited 1.345.766.034 14,33 Harvest Agents LimitedKingdom Industrial Limited 1.064.706.380 11,34 Kingdom Industrial LimitedPT Sietek Nusantara Finance 20.018.500 0,21 PT Sietek Nusantara FinanceMasyarakat (masing-masing dengan

kepemilikan kurang dari 5%) 5.498.960.138 58,56 Public (each below 5% of ownership) Jumlah 9.391.108.493 100,00 Total

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/71 Exhibit E/71

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

28. TAMBAHAN MODAL DISETOR BERSIH (Lanjutan) 28. ADDITIONAL PAID-IN CAPITAL NET (Continued)

Rincian tambahan modal disetor sebelum dan setelahkuasi-reorganisasi adalah sebagai berikut:

Details of additional paid in capital before and afterquasi- reorganization are as follows:

Jumlah/Total Rp Penawaran umum saham ke

masyarakat pada tahun 1996 100.241.500.000 Public offering in 1996Konversi obligasi menjadi Conversion of bonds in to shares

saham pada tahun 1997 dan 1998 756.366.000 in 1997 and 1998 Konversi obligasi menjadi

saham pada tahun 2005 124.893.333.339 Conversion of bonds in to shares in 2005Konversi utang sewa pembiayaan Conversion of obligation under capital

menjadi saham pada tahun 2005 22.451.140.323 lease in to shares in 2005 Biaya emisi saham ( 10.867.860.067) Stock issuance costs 237.474.479.595 Penyesuaian dalam rangka kuasi-

reorganisasi Quasi-reorganization adjustmentPenurunan nilai nominal saham Reduction of share par value without

tanpa mengurangi jumlah reducing the number of saham beredar 2.031.663.655.945 outstanding shares

Eliminasi saldo defisit dalam Elimination of deficit balance in rangka kuasi-reorganisasi ( 2.269.137.378.701) term of Quasi - Reorganization

Saldo setelah Kuasi-Reorganisasi 756.839 Balance after Quasi-Reorganization

29. DIVIDEN 29. DIVIDEND

Berdasarkan hasil keputusan Rapat Umum Pemegang Saham Tahunan yang diselenggarakan pada tanggal 16 Juni 2011 yang telah dituangkan dalam akta Berita Acara No. 153 dari Dr. Irawan Soerodjo, SH, MSi, Notaris di Jakarta, diantaranya memutuskan penggunaan laba bersih Perusahaan tahun 2010 sebagai berikut:

Based on the Annual General Meeting of Shareholders, held on 16 Juni 2011, which were covered in minutes by Notarial Deed No. 153 from Dr. Irawan Soerodjo, SH, a Notary in Jakarta, including decided to use the Companys net income in 2010 as follows:

Sebesar Rp 9.391.108.493 atau 15,4% dari laba

bersih Perusahaan tahun 2010, dibagikan sebagai dividen tunai kepada para pemegang saham Perusahaan sehingga setiap saham akan memperoleh dividen tunai sebesar Rp 1 (satu Rupiah);

Amounted to Rp 9,391,108,493 or 15.4% from Companys net income in 2010, distributed as cash dividends to shareholders Company that each share will get cash dividend amounted to Rp 1 (one Rupiah);

Sebesar Rp 3.057.415.309 dialokasikan dan

dibukukan sebagai dana cadangan; Amounted to Rp 3,057,415,309 was allocated

and recorded as reserve fund;

Sisanya dibukukan sebagai laba ditahan yang akan digunakan untuk menambah modal kerjaPerusahaan.

The remaining is recorded as retained earning which is used for additional Companys working capital.

Pada tanggal 10 November 2011 dividen tunai telah dibayar.

On 10 November 2011, the cash dividend had been paid.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/70 Exhibit E/70

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

27. MODAL SAHAM (Lanjutan) 27. SHARE CAPITAL (Continued)

Berdasarkan Berita Acara Rapat Umum Pemegang Saham Luar Biasa yang didokumentasikan dalam akta No. 223 tanggal 22 Desember 2009 dibuat dihadapan Dr. Irawan Soerodjo, SH, MSi, Notaris di Jakarta, para pemegang saham menyetujui untuk melaksanakan kuasi-reorganisasi (lihat Catatan 41), menyetujui perubahan anggaran dasar Perusahaan berupa penurunan modal dasar dari sebesar Rp 8.831.637.901.700 menjadi sebesar Rp 3.842.092.971.055, serta menyetujui penurunan modal ditempatkan dan disetor Perusahaan dari sebesar Rp 3.184.291.525.400 menjadi Rp 1.152.627.869.455 dengan cara menurunkan nilai nominal saham Perusahaan dari semula senilai Rp 5.000 per saham untuk saham seri A dan Rp 3.000 per saham untuk saham seri B, keduanya menjadi Rp 395 per saham.

Based on deeds of the Company's Extraordinary General Meeting of Shareholders No. 223 made before Dr. lrawan Soerodjo, SH, MSi, a Notary in Jakarta, dated 22 December 2009, the shareholders approved the execution of quasi-reorganization (see Note 41), approving the amendment on articles of association by reducing the authorized capital from Rp 8,831,637,901,700 to Rp 3,842,092,971,055, as well as approving the reduction in issued and paid-in capital from Rp 3,184,291,525,400 and Rp 1,152,627,869,455 through reducing the shares par value from Rp 5,000 per share for A series shares and Rp 3,000 per share for B series shares, both were reduced to Rp 395 per share.

Modal dasar setelah perubahan anggaran dasar ini adalah sebagai berikut:

Authorized capital after the amendment the of articles of association is as follows:

Jumlah saham/ Nilai

Nominal/

Jumlah/

Total shares Par value Total Pemegang Saham (Lembar/Shares) (Rp) (Rp) Stockholder Seri A 73.099.900 395 28.874.460.500 A SeriesSeri B 650.686.609 395 257.021.210.555 B SeriesSeri C 35.561.973.000 100 3.556.197.300.000 C Series Total Modal Dasar 36.285.759.509 3.842.092.971.055 Total Capital Stock

Perubahan anggaran dasar tersebut telah mendapat persetujuan dari Menteri Hukum dan Hak Asasi Manusia Republik Indonesia dalam Surat No. AHU-11399.AH.01.02.Tahun 2010 pada tanggal 4 Maret 2010.

The amendment of articles of association was approved by the Minister of Justice and Human Rights of the Republic Indonesia in his decree No. AHU-11399.AH.01.02.Year 2010 dated 4 March 2010.

28. TAMBAHAN MODAL DISETOR - BERSIH 28. ADDITIONAL PAID-IN CAPITAL - NET

Berdasarkan Berita Acara Rapat Umum Pemegang Saham Luar Biasa yang didokumentasikan dalam akta No. 223 tanggal 22 Desember 2009, dibuat dihadapan Dr. Irawan Soerodjo, SH, MSi, Notaris di Jakarta, para pemegang saham menyetujui untuk melaksanakan kuasi-reorganisasi sehingga tambahan modal disetor Perusahaan mengalami perubahan (lihat Catatan 41).

Based on deeds the Companys Extraordinary General Meeting of Shareholders No. 223 made before Dr. lrawan Soerodjo, SH, MSi, a Notary in Jakarta, dated 22 December 2009, the shareholders approved to executing quasi-reorganization, therefore the additional paid in capital of the Company is changed accordingly (see Note 41).

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/71 Exhibit E/71

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

28. TAMBAHAN MODAL DISETOR BERSIH (Lanjutan) 28. ADDITIONAL PAID-IN CAPITAL NET (Continued)

Rincian tambahan modal disetor sebelum dan setelahkuasi-reorganisasi adalah sebagai berikut:

Details of additional paid in capital before and afterquasi- reorganization are as follows:

Jumlah/Total Rp Penawaran umum saham ke

masyarakat pada tahun 1996 100.241.500.000 Public offering in 1996Konversi obligasi menjadi Conversion of bonds in to shares

saham pada tahun 1997 dan 1998 756.366.000 in 1997 and 1998 Konversi obligasi menjadi

saham pada tahun 2005 124.893.333.339 Conversion of bonds in to shares in 2005Konversi utang sewa pembiayaan Conversion of obligation under capital

menjadi saham pada tahun 2005 22.451.140.323 lease in to shares in 2005 Biaya emisi saham ( 10.867.860.067) Stock issuance costs 237.474.479.595 Penyesuaian dalam rangka kuasi-

reorganisasi Quasi-reorganization adjustmentPenurunan nilai nominal saham Reduction of share par value without

tanpa mengurangi jumlah reducing the number of saham beredar 2.031.663.655.945 outstanding shares

Eliminasi saldo defisit dalam Elimination of deficit balance in rangka kuasi-reorganisasi ( 2.269.137.378.701) term of Quasi - Reorganization

Saldo setelah Kuasi-Reorganisasi 756.839 Balance after Quasi-Reorganization

29. DIVIDEN 29. DIVIDEND

Berdasarkan hasil keputusan Rapat Umum Pemegang Saham Tahunan yang diselenggarakan pada tanggal 16 Juni 2011 yang telah dituangkan dalam akta Berita Acara No. 153 dari Dr. Irawan Soerodjo, SH, MSi, Notaris di Jakarta, diantaranya memutuskan penggunaan laba bersih Perusahaan tahun 2010 sebagai berikut:

Based on the Annual General Meeting of Shareholders, held on 16 Juni 2011, which were covered in minutes by Notarial Deed No. 153 from Dr. Irawan Soerodjo, SH, a Notary in Jakarta, including decided to use the Companys net income in 2010 as follows:

Sebesar Rp 9.391.108.493 atau 15,4% dari laba

bersih Perusahaan tahun 2010, dibagikan sebagai dividen tunai kepada para pemegang saham Perusahaan sehingga setiap saham akan memperoleh dividen tunai sebesar Rp 1 (satu Rupiah);

Amounted to Rp 9,391,108,493 or 15.4% from Companys net income in 2010, distributed as cash dividends to shareholders Company that each share will get cash dividend amounted to Rp 1 (one Rupiah);

Sebesar Rp 3.057.415.309 dialokasikan dan

dibukukan sebagai dana cadangan; Amounted to Rp 3,057,415,309 was allocated

and recorded as reserve fund;

Sisanya dibukukan sebagai laba ditahan yang akan digunakan untuk menambah modal kerjaPerusahaan.

The remaining is recorded as retained earning which is used for additional Companys working capital.

Pada tanggal 10 November 2011 dividen tunai telah dibayar.

On 10 November 2011, the cash dividend had been paid.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/73 Exhibit E/73

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

33. BEBAN UMUM DAN ADMINISTRASI 33. GENERAL AND ADMINISTRATIVE EXPENSES

2 0 1 1 2 0 1 0 Gaji dan tunjangan 92.132.948.645 78.922.183.236 Salaries and benefitsBeban kantor 18.919.370.169 14.022.687.974 Office expensesSewa dan asuransi 18.722.766.048 11.806.149.859 Rent and insurancePenyisihan uang jasa 14.680.423.575 5.369.930.411 Provision for employee benefitsPenyusutan aset tetap Depreciation of property and equipment

(Catatan 15) 10.184.725.694 8.931.782.825 (Note 15) Perbaikan dan pemeliharaan 8.901.377.030 7.534.478.482 Repairs and maintenanceBeban dan denda pajak 6.219.484.091 309.167.777 Tax penaltiesSumbangan dan perjamuan 5.927.725.101 2.254.843.968 Donations and entertainmentJasa professional 5.226.191.529 4.656.328.259 Professional feesTransportasi dan akomodasi 4.305.858.264 3.605.160.298 Transportation and accommodationBeban administrasi bank 3.960.316.586 4.088.345.725 Bank administration expensesPerizinan dan lisensi 3.718.538.120 3.183.990.415 Permits and licensesBiaya rapat 523.026.759 316.160.166 Meeting expensesBeban amortisasi aset tidak berwujud 634.932.496 - Amortization expense of intangible assetsIklan dan promosi 122.393.256 1.612.393.560 Advertising and promotionsLain-lain 310.083.272 120.957.176 Others Jumlah 194.490.160.635 146.734.560.131 T o t a l

34. PENJUALAN LAIN-LAIN 34. SALES OF SCRAPS

Akun ini merupakan hasil penjualan di luar aktivitas utama Perusahaan seperti penjualan karung, sweeping dan lain-lain masing-masing sebesar Rp 3.429.639.826 dan Rp 2.588.376.731 untuk tahun yang berakhir 31 Desember 2011 dan 2010.

This account represents proceeds from sale outside of the Company's primary activity such as sales of sacks and sweeping and others amounted to Rp 3,429,639,826and Rp 2,588,376,731 for the year ended 31 December 2011 and 2010, respectively.

35. LABA PER SAHAM 35. EARNINGS PER SHARE

Perhitungan laba per saham adalah sebagai berikut: Calculation of earnings per share is as follows:

2 0 1 1 2 0 1 0 Jumlah laba yang diatribusikan kepada

pemilik entitas induk 22.067.819.087

61.148.306.170 Profit attributable to owners of the

parent Number of weighted average sharesJumlah saham biasa beredar 9.391.108.493 9.391.108.493 Outstanding Laba bersih per saham dasar 2,35 6,51 Basic earnings per share

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/72 Exhibit E/72

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

30. PENJUALAN BERSIH 30. NET SALES

2 0 1 1 2 0 1 0 Perunggasan 3.922.039.497.284 3.613.858.354.992 PoultryPeralatan dan Lain-lain 35.732.054.922 28.642.505.357 Poultry equipment and othersMakanan siap saji 71.359.471.422 - Fast food Jumlah 4.029.131.023.628 3.642.500.860.349 T o t al

Pada tahun 2011 dan 2010 tidak terdapat penjualan ke pihak ketiga yang melebihi 10% dari total pendapatan.

In 2011 and 2010 there were no sales to third parties that exceed 10% of total revenue.

31. BEBAN POKOK PENJUALAN 31. COST OF GOODS SOLD

2 0 1 1 2 0 1 0 Bahan baku yang digunakan 3.258.696.377.270 2.992.630.021.024 Raw Materials UsedTenaga kerja langsung 37.082.254.024 30.496.595.458 Direct LaborBiaya produksi tidak langsung 209.929.286.790 168.696.670.935 Factory OverheadBeban deplesi 109.124.631.827 98.323.724.457 Depletion Cost Beban Pokok Produksi 3.614.832.549.911 3.290.147.011.874 Cost of Good Manufactured Persediaan Barang Jadi Finished Goods Inventories at

Awal tahun 47.579.497.189 48.487.649.008 Beginning of Year Entitas anak yang diakuisisi 7.371.983.531 - Acquired subsidiaries Akhir tahun ( 62.234.462.438 ) ( 47.579.497.189) End of Year

Jumlah Beban Pokok Penjualan 3.607.549.568.193 3.291.055.163.693 Total Cost of Goods Sold

Toepfer International Asia Pte. Ltd. merupakan pemasok bahan baku pakan ternak Perusahaan dengan jumlah pembelian sebesar Rp 588.215.090.553 dan Rp 374.996.373.381, atau 29,58% dan 18,97% dari total pembelian bahan baku ternak masing-masing pada tahun 2011 dan 2010 (lihat juga Catatan 37b).

Toepfer International Asia Pte.Ltd. is the Company's raw material feed supplier with total purchases of Rp 588,215,090,553 and Rp 374,996,373,381 or 29.85%and 18.97% from total purchase of raw material in 2011 and 2010, respectively (see also Note 37b).

32. BEBAN PENJUALAN 32. SELLING EXPENSES

2 0 1 1 2 0 1 0 Perjalanan dinas, pengangkutan

dan pengiriman 29.653.414.372 22.764.144.014 Travel, freight and deliveryGaji dan tunjangan 17.714.289.905 10.173.850.605 Salaries and benefitsIklan dan promosi 12.740.645.316 12.082.136.082 Advertisement and promotionsPenyusutan aset tetap Depreciation of property and

(Catatan 15) 11.055.883.485 5.457.735.471 equipment (Note 15) Sewa dan asuransi 9.805.069.243 5.420.826.566 Rent and insuranceBeban kantor 9.349.400.935 4.440.233.231 Office expensesPerbaikan dan pemeliharaan 6.253.943.507 2.196.344.638 Repairs and maintenanceLain-lain 1.095.686.196 1.995.039.545 Other Jumlah 97.668.332.959 64.530.310.152 T o t a l

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/73 Exhibit E/73

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

33. BEBAN UMUM DAN ADMINISTRASI 33. GENERAL AND ADMINISTRATIVE EXPENSES

2 0 1 1 2 0 1 0 Gaji dan tunjangan 92.132.948.645 78.922.183.236 Salaries and benefitsBeban kantor 18.919.370.169 14.022.687.974 Office expensesSewa dan asuransi 18.722.766.048 11.806.149.859 Rent and insurancePenyisihan uang jasa 14.680.423.575 5.369.930.411 Provision for employee benefitsPenyusutan aset tetap Depreciation of property and equipment

(Catatan 15) 10.184.725.694 8.931.782.825 (Note 15) Perbaikan dan pemeliharaan 8.901.377.030 7.534.478.482 Repairs and maintenanceBeban dan denda pajak 6.219.484.091 309.167.777 Tax penaltiesSumbangan dan perjamuan 5.927.725.101 2.254.843.968 Donations and entertainmentJasa professional 5.226.191.529 4.656.328.259 Professional feesTransportasi dan akomodasi 4.305.858.264 3.605.160.298 Transportation and accommodationBeban administrasi bank 3.960.316.586 4.088.345.725 Bank administration expensesPerizinan dan lisensi 3.718.538.120 3.183.990.415 Permits and licensesBiaya rapat 523.026.759 316.160.166 Meeting expensesBeban amortisasi aset tidak berwujud 634.932.496 - Amortization expense of intangible assetsIklan dan promosi 122.393.256 1.612.393.560 Advertising and promotionsLain-lain 310.083.272 120.957.176 Others Jumlah 194.490.160.635 146.734.560.131 T o t a l

34. PENJUALAN LAIN-LAIN 34. SALES OF SCRAPS

Akun ini merupakan hasil penjualan di luar aktivitas utama Perusahaan seperti penjualan karung, sweeping dan lain-lain masing-masing sebesar Rp 3.429.639.826 dan Rp 2.588.376.731 untuk tahun yang berakhir 31 Desember 2011 dan 2010.

This account represents proceeds from sale outside of the Company's primary activity such as sales of sacks and sweeping and others amounted to Rp 3,429,639,826and Rp 2,588,376,731 for the year ended 31 December 2011 and 2010, respectively.

35. LABA PER SAHAM 35. EARNINGS PER SHARE

Perhitungan laba per saham adalah sebagai berikut: Calculation of earnings per share is as follows:

2 0 1 1 2 0 1 0 Jumlah laba yang diatribusikan kepada

pemilik entitas induk 22.067.819.087

61.148.306.170 Profit attributable to owners of the

parent Number of weighted average sharesJumlah saham biasa beredar 9.391.108.493 9.391.108.493 Outstanding Laba bersih per saham dasar 2,35 6,51 Basic earnings per share

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/75 Exhibit E/75

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

37. IKATAN DAN PERJANJIAN 37. COMMITMENTS AND AGREEMENTS

a. Perjanjian Lisensi Merek a. Trade Mark License Agreement

Pada tanggal 16 April 2001, berdasarkan perjanjian lisensi merek, Perusahaan menyetujui PT Belfoods Indonesia (BI) untuk memproduksi dan memasarkan produk dengan merek dagang Delfarm. Produksi dilakukan oleh BI terhitung sejak tanggal 1 Juni 2001. Perusahaan berhak mendapatkan royalti sebesar 2% yang dihitung dari keseluruhan angka penjualan bersih (fixed price). Perjanjian ini telah beberapa kali diamandemen, terakhir berdasarkan amandemen perjanjian pada tanggal 31 Desember 2009, yang memperpanjang jangka waktu perjanjian ini sampai dengan 31 Desember 2011.

On 16 April 2001, based on Trade Mark License Agreement, the Company has appointed PT Belfoods lndonesia (BI) to produce and distribute a product with trade mark of "Delfarm". BI started it production on 1 June 2001. The Company entitled for royalty fee which is computed based on total net sales (fixed price). This agreement has been amended several times, most recently based on amendment dated 31 December 2009, which extended up to 31 December 2011.

b. Stock Financing Agreement b. Stock Financing Agreement

Pada tanggal 1 Januari 2001, Perusahaan menandatangani stock financing agreement dengan Toepfer International - Asia Pte. Ltd., Singapura (Toepfer). Perjanjian ini telah beberapa kali mengalami perubahan, terakhir berdasarkan amandemen kedua pada tanggal 10 Januari 2002.Perjanjian ini berakhir bila salah satu pihak menyatakan pembatalan perjanjian ini secara tertulis, yang berlaku efektif 60 (enam puluh) hari setelah pernyataan tertulis tersebut.

On 1 January 2001, the Company entered into stock financing agreement with Toepfer International Asia Pte.Ltd. Singapore (Toepfer). This agreement has been amended several times, most recently based on second amendment dated 10 January 2002. The agreement may be terminated upon either party giving sixty (60) days notice in writing.

Dalam perjanjian ini Toepfer bersedia untuk menyediakan dan menjual bahan baku berupa yellow corn, soyabeanmeal, soyabean dan corn glutten meal kepada Perusahaan dengan harga yang kompetitif. Fasilitas yang diberikan Toepfer ini adalah sebesar 85% dari harga pembelian. Adapun detail jenis barang, kuantitas, uang muka maupun spesifikasi bahan baku akan dituangkan dalam sales contract per pengiriman barang.

According to this agreement, Toepfer agreed to provide and sell raw materials of yellow corn, soyabean meal, soyabean and corn gluten meal to the Company with a competitive price. Toepfer provided credit facility up to 85% (eighty five percent) of purchases price. Other related details concerning type of goods, quantity, advance payment, or the specification of raw material will be determined in each sales contract made for each delivery of goods.

Kepemilikan barang dengan fasilitas stock financingini akan tetap pada Toepfer sampai dengan Perusahaan membayar penuh harga pembelian, biaya perolehan (carrying cost) dan Collateral Management Agreement (CMA) fee. Selain biaya perolehan dan CMA fee, Perusahaan juga menanggung semua biaya pengadaan barang import tersebut termasuk susut pengiriman.

The right of merchandise under stock financing shall remain with Toepfer until the Company has fully paid of the purchases price, carrying cost and Collateral Management Agreement (CMA) fee. Other than the carrying cost and CMA fee, the Company shall bear all acquisition cost of import goods included of shrinkage during shipment.

Toepfer selanjutnya menunjuk Sucofindo atau pihak lain sebagai kustodian yang mengelola barang tersebut sesuai dengan CMA. Dalam hal Perusahaan tidak bisa memenuhi liabilitas yang diatur dalam perjanjian (even of default), Toepfer tidak lagi berkewajiban menyediakan barang kepada Perusahaan, dan Toepfer sebagai pemilik barang berhak menarik kembali barang dari gudang dan Perusahaan harus menanggung beban penarikan dan perbedaan kuantitas jika ada.

Toepfer, subsequently appointed Sucofindo or otherparties as a custodian of the merchandise to manage the goods in according to CMA. In the event of the Company fails to fulfill its obligation as governed in the agreement ("even of default'), Toepfer should not be obliged to provide goods to the Company, and as holder of the title thereto, Toepfer is entitled to remove such merchandise from warehouse and the Company should bear the cost of removal and lost of difference in quantities, if any.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/74 Exhibit E/74

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

36. TRANSAKSI DENGAN PIHAK-PIHAK BERELASI 36. NATURE AND TRANSACTION WITH RELATED

PARTIES

2 0 1 1

Persentase terhadap jumlah aset/

Percetage of total assets 2 0 1 0

Persentase terhadap jumlah aset/

Percetage of total assets

Piutang pihak-pihak berelasi:

Due from relatedparties:

PT Sietek Nusantara Finance

20.915.609.028 0,79 % 24.058.762.828 1,18 % PT Sietek NusantaraFinance

PT Sierad Land 5.169.162.816 0,20 % 6.425.353.286 0,32 % PT Sierad LandPT Bridor Indonesia 376.763.296 0,01 % 376.763.296 0,02 % PT Bridor IndonesiaLain-lain (masing-masing Others (each below

di bawah Rp 50 juta) 55.636.525 0,002 % 55.636.525 0,003 % Rp 50 million) Jumlah 26.517.171.665 1,00 % 30.916.515.935 1,52 % Total

Akun ini merupakan piutang tanpa bunga dan jaminan, yang timbul dari transaksi beban operasional pihak-pihak berelasi yang dibayarkan terlebih dahulu oleh Grup.

This account mainly consists of non-interest bearing intercompany loan and not secured, arising fromoperational cost which was paid by Group.

Berdasarkan Perjanjian Utang dan Rencana Pembayaran tanggal 31 Desember 2009, piutang dari PT SietekNusantara Finance dan PT Sierad Land akan dilunasi secara angsuran selama 3 (tiga) tahun terhitung sejak bulan Mei 2010.

Based on Loan and Repayment Agreement dated31 December 2009, due from PT Sietek Nusantara Finance and PT Sierad Land will be paid on installment basis for 3 years starting from May 2010.

Rincian sifat hubungan dengan pihak-pihak berelasiPerusahaan adalah sebagai berikut:

Nature of relationship with related parties is as follows:

No. Pihak pihak Berelasi/ Sifat Hubungan dengan Pihak-pihak Berelasi/ Related Parties Nature of Relationship

1 PT Sietek Nusantara Finance Pemegang Saham Perusahaan/ Companys shareholders 2 PT Sierad Land Mempunyai mayoritas Pengurus yang sama/ Same Majority

Management 3 PT Bridor Indonesia Perusahaan Asosiasi/ Associated Companies

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/75 Exhibit E/75

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

37. IKATAN DAN PERJANJIAN 37. COMMITMENTS AND AGREEMENTS

a. Perjanjian Lisensi Merek a. Trade Mark License Agreement

Pada tanggal 16 April 2001, berdasarkan perjanjian lisensi merek, Perusahaan menyetujui PT Belfoods Indonesia (BI) untuk memproduksi dan memasarkan produk dengan merek dagang Delfarm. Produksi dilakukan oleh BI terhitung sejak tanggal 1 Juni 2001. Perusahaan berhak mendapatkan royalti sebesar 2% yang dihitung dari keseluruhan angka penjualan bersih (fixed price). Perjanjian ini telah beberapa kali diamandemen, terakhir berdasarkan amandemen perjanjian pada tanggal 31 Desember 2009, yang memperpanjang jangka waktu perjanjian ini sampai dengan 31 Desember 2011.

On 16 April 2001, based on Trade Mark License Agreement, the Company has appointed PT Belfoods lndonesia (BI) to produce and distribute a product with trade mark of "Delfarm". BI started it production on 1 June 2001. The Company entitled for royalty fee which is computed based on total net sales (fixed price). This agreement has been amended several times, most recently based on amendment dated 31 December 2009, which extended up to 31 December 2011.

b. Stock Financing Agreement b. Stock Financing Agreement

Pada tanggal 1 Januari 2001, Perusahaan menandatangani stock financing agreement dengan Toepfer International - Asia Pte. Ltd., Singapura (Toepfer). Perjanjian ini telah beberapa kali mengalami perubahan, terakhir berdasarkan amandemen kedua pada tanggal 10 Januari 2002.Perjanjian ini berakhir bila salah satu pihak menyatakan pembatalan perjanjian ini secara tertulis, yang berlaku efektif 60 (enam puluh) hari setelah pernyataan tertulis tersebut.

On 1 January 2001, the Company entered into stock financing agreement with Toepfer International Asia Pte.Ltd. Singapore (Toepfer). This agreement has been amended several times, most recently based on second amendment dated 10 January 2002. The agreement may be terminated upon either party giving sixty (60) days notice in writing.

Dalam perjanjian ini Toepfer bersedia untuk menyediakan dan menjual bahan baku berupa yellow corn, soyabeanmeal, soyabean dan corn glutten meal kepada Perusahaan dengan harga yang kompetitif. Fasilitas yang diberikan Toepfer ini adalah sebesar 85% dari harga pembelian. Adapun detail jenis barang, kuantitas, uang muka maupun spesifikasi bahan baku akan dituangkan dalam sales contract per pengiriman barang.

According to this agreement, Toepfer agreed to provide and sell raw materials of yellow corn, soyabean meal, soyabean and corn gluten meal to the Company with a competitive price. Toepfer provided credit facility up to 85% (eighty five percent) of purchases price. Other related details concerning type of goods, quantity, advance payment, or the specification of raw material will be determined in each sales contract made for each delivery of goods.

Kepemilikan barang dengan fasilitas stock financingini akan tetap pada Toepfer sampai dengan Perusahaan membayar penuh harga pembelian, biaya perolehan (carrying cost) dan Collateral Management Agreement (CMA) fee. Selain biaya perolehan dan CMA fee, Perusahaan juga menanggung semua biaya pengadaan barang import tersebut termasuk susut pengiriman.

The right of merchandise under stock financing shall remain with Toepfer until the Company has fully paid of the purchases price, carrying cost and Collateral Management Agreement (CMA) fee. Other than the carrying cost and CMA fee, the Company shall bear all acquisition cost of import goods included of shrinkage during shipment.

Toepfer selanjutnya menunjuk Sucofindo atau pihak lain sebagai kustodian yang mengelola barang tersebut sesuai dengan CMA. Dalam hal Perusahaan tidak bisa memenuhi liabilitas yang diatur dalam perjanjian (even of default), Toepfer tidak lagi berkewajiban menyediakan barang kepada Perusahaan, dan Toepfer sebagai pemilik barang berhak menarik kembali barang dari gudang dan Perusahaan harus menanggung beban penarikan dan perbedaan kuantitas jika ada.

Toepfer, subsequently appointed Sucofindo or otherparties as a custodian of the merchandise to manage the goods in according to CMA. In the event of the Company fails to fulfill its obligation as governed in the agreement ("even of default'), Toepfer should not be obliged to provide goods to the Company, and as holder of the title thereto, Toepfer is entitled to remove such merchandise from warehouse and the Company should bear the cost of removal and lost of difference in quantities, if any.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/77 Exhibit E/77

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

37. IKATAN DAN PERJANJIAN (Lanjutan) 37. COMMITMENTS AND AGREEMENTS (Continued)

c. Kontrak Kerjasama Kemitraan (Lanjutan) c. Partnership Contract (Continued)

Untuk menjamin pembayaran dari usaha kemitraan baik wilayah barat dan wilayah timur, Perusahaan menerima jaminan aset yang disertai dengan surat kuasa sebesar nilai kontrak yang telah disepakati. Jaminan tersebut berupa tanah, bangunan, deposito dan kendaraan dengan nilai jaminan keseluruhan pada 31 Desember 2011 adalah sebesar Rp 265.541.411.305 (2010: Rp 204.525.215.390)

To secure the payment from this cooperative partnership in west and east area, the Company has received certain assets with its power of attorney which value is equal to the agreed contract as the collateral. The collateral consists of land, buildings, deposit and vehicles amounting to Rp 265,541,411,305 as of 31 December 2011 (2010: Rp 204,525,215,390)

Jaminan aset yang diterima Perusahaan tersebut tidak dicatat dalam laporan keuangan Perusahaan. Jaminan ini akan dikembalikan bila kerjasama kemitraan ini diakhiri.

The collateral assets received by the Company are not recorded in the Company's financial statements. The collaterals are returnable when the partnership contract is terminated.

Perjanjian kerjasama ini dilakukan dalam jangka waktu 1 tahun sejak ditanda-tanganinya surat perjanjian, dan dapat diperpanjang kembali sesuai kesepakatan antara Perusahaan dan pemilik lahan ternak.

This contract is valid for one year since date of signing of the agreement, and can be extended based on the approval from the Company and farm owners.

d. Fasilitas Pembiayaan Waad Al Murabahah d. Wa'd Al Murabahah Financing Facility Berdasarkan Surat Persetujuan Pemberian Kredit No.252/OL/301/XI/11, Perusahaan mendapatkan Fasilitas Pembiayaan Wad Al Murabahah dari PT Bank Muamalat Indonesia sebesar Rp 100.000.000.000 yang akan digunakan untuk pembelian bahan bangunan dan peralatan untuk pembangunan 4 unit commercial farm. Jangka waktu fasilitas adalah 60 bulan sejak penarikan pertama. Sampai dengan 31 Desember 2011 Perusahaan belum menggunakan Fasilitas pembiayaan ini.

Based on the Letter of Credit Agreement No.252/OL/301/XI/11, the Company obtained Wa'd Al Murabahah Financing Facility of PT Bank Muamalat Indonesia amounting to Rp 100 billion and will be used to purchase construction materials and equipment for the construction of four unit commercial farm. The term of loan is 60 months from the first drawdown. Up to 31 December 31, 2011 the Company has not used this financing facility.

Atas fasilitas pembiayaan ini Perusahaan harus menyerahkan jaminan berupa Tanah dan Bangunan (4 Commercial Farm) yang akan dibangun dengan dana pembiayaan dari PT Bank Muamalat Indonesia.

This financing facility is secured by the Land and Buildings (4 Commercial Farm) to be built with funding from the financing of PT Bank Muamalat Indonesia.

38. KONTINJENSI 38. CONTINGENCIES

a. Sesuai dengan Perkara No. 3079K/Pdt/1999 jo. Nomor : 513/Pdt/1995/PT.Bdg, tanggal 16 April 1997 jo. Nomor 12/Pdt/G/Bth/1993/PN.Bgr, tanggal 15 Februari 1995 antara Perusahaan melawan Indra Wirantono Cs. Perkara ini bermula dari adanya Penetapan Ketua Pengadilan Negeri Bogor Nomor : 02/DEL/SITA EKS/PDT/1993/PN.Bgr tanggal 7 Agustus 1993 yang akan melakukan sita eksekusiatas bangunan yang berdiri di atas tanah seluas 10,84 ha, sebagaimana tercantum dalam Sertifikat Hak Guna Bangunan No.02 /Cibinong, tercatat atas nama PT. Oerip Wirajaya Poultry. Saham Perseroan Terbatas tersebut telah diambil alih oleh Perusahaan pada tanggal 11 Januari 1991 dari Tn. H. Wirantono & PT. NV Perusahaan Dagang dan Industry Wirantono & Co. Ltd. N.V. sehingga sejak saat itu seluruh saham PT. Oerip Wirajaya Poultry dimiliki oleh Perusahaan, dan selanjutnya lokasi perusahaan tersebut dipergunakan sebagai salah satu lokasi pembibitan anak ayam umur sehari (DOC).

a. In relation to the Matter No. 3079K/Pdt/1999 jo. Number: 513/Pdt/1995/PT.Bdg, dated 16 April 1997 jo. Number 12/Pdt/G/Bth/1993/PN.Bgr, dated February 15, 1995 between Company oppose Indra Wirantono Cs. This matter began from the decreeissued by the State Court of Bogor No.: 02/DEL/SITA EKS/PDT/1993/PN.Bgr dated 7 August 1993 which will execute confiscation of the building consisting the land area of 10.84 ha, as stated in the certificate Hak Guna Bangunan No.02 / Cibinong, registered in the name of PT. Oerip Wirajaya Poultry. Such Companys shares have been taken over by the Company on 11 January 1991 from Mr. H. Wirantono & PT. Trade and Industry Company NV Wirantono & Co. Ltd. N.V. so since that time all the shares of PT. Oerip Wirajaya Poultry are owned by the Company, and then the location of suchcompany is used by the Company as breeding location for day old chicks (DOC).

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/76 Exhibit E/76

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

37. IKATAN DAN PERJANJIAN (Lanjutan) 37. COMMITMENTS AND AGREEMENTS (Continued)

c. Kontrak Kerjasama Kemitraan c. Partnership Contract

Perusahaan melakukan kerjasama dengan pola kemitraan dengan masyarakat pemilik atau penyewalahan tanah dan bangunan kandang ayam (anggota mitra) yang merupakan kerjasama saling ketergantungan dan saling menguntungkan antara Perusahaan dengan anggota mitra, dengan pendekatan agribisnis untuk menangani seluruhsegmen agribisnis dengan pengadaan/ penyaluran sarana produksi peternakan penyediaan bibit ayampedaging umur sehari (DOC Broiler), pakan ternak, obat, vaksin (sapronak) serta pengolahan termasuk pemasaran hasil ternak. Kerjasama ini terutama ditujukan untuk menjaga kontinuitas pasokan bahan baku untuk industri pemotongan ayam Perusahaan (slaughter house) serta menjaga stabilitas pasar untuk produk DOC dan pakan ayam yang diproduksi oleh Perusahaan.

The Company had entered into a co-perative partnership agreement with a community of the owners and lender of chicken farms (partners), which is considered as dependent and mutually beneficial agreement, with an agribusiness approach, to maintain of all agribusiness segment from supplying husbandry infrastructure providingbroiler day old chicken (DOC Broiler), feed,medicines and sapronak vaccines and producing including the distribute live stock. This partnership is intended primarily to keep the continuity of raw material supply for the Company's slaughter house and to maintain market price stability of DOC and feed produced by the Company.

Pada kerjasama kemitraan, Perusahaan akan menyediakan seluruh kebutuhan bahan-bahan peternakan ayam yang terdiri dari bibit (DOC), pakan ternak, obat-obatan dan vaksin (sapronak) dengan harga tertentu yang akan diperhitungkan pada saat penjualan hasil dilakukan. Selain itu, Perusahaan juga akan memberikan bimbingan teknis produksi administrasi, bantuan akses pasar, konsultasi tenaga kerja, sebagai mediator terhadap sumber-sumber pembiayaan, manajemen produksi dan kontrol kualitas bagi anggota mitra.

According to the partnership contract, the Company shall provide all the necessary things related to the poultry such as DOC, feeds, vaccines, and medicines with the certain prices and will be compensated with the products sold. The Company also will give the technical support for production, market access, and as a mediator towards financing sources, production management and quality control towards partners.

Kerjasama kemitraan ini terbagi atas dua wilayah operasi yaitu Wilayah Barat yang meliputi Jawa Barat dan Banten serta Wilayah Timur yang meliputi Jawa Timur dan Jawa Tengah, dengan jumlah mitra per 31 Desember 2011 dan 2010, masing-masing sebanyak 2.695 dan 2.669 mitra, dengan nilai penjualan sapronak Perusahaan kepada para anggota mitra per 31 Desember 2011 dan 2010, masing-masing sebesar Rp 1.103.891.104.249 dan Rp 875.165.881.390, dan penjualan ayam ternakyang berasal dari kerjasama kemitraan ini pada tahun 2011 dan 2010 masing-masing sebesar Rp 1.027.087.309.268 dan Rp 975.070.989.380.

This partnership contract is divided into two operation area such as west side covering West Java area and Banten and east side covering East Java and Central Java, with the number of partner amounted to 2,695 and 2,669 partners as of 31 December 2011 and 2010, respectively and total sales of sapronak package from the Company to the partners amounted to Rp 1,103,891,104,249 and Rp 875,165,881,390 and sales of chicken livestockfrom this co-operative partnership in 2011 and 2010amounted to Rp 1,027,087,309,268 andRp 975.070.989.380, respectively.

Anggota kemitraan akan memasarkan ayam hasil panen yang telah dibudidayakan dan Perusahaanmembantu mitra dalam memasarkan hasil ternaktersebut. Bila harga kesepakatan lebih kecil dari harga pasar, Perusahaan akan memberikan bonus dan bila harga kesepakatan lebih besar dari harga pasar, Perusahaan akan mengganti sesuai dengankesepakatan.

Partnership members will sell the chicken livestock and the Company will assist them. Bonuses will be paid by the Company if the agreed price is lower than market price and if the agreed price is higher than the market price, the Company will pay according the agreement. The Company will pay according to the agreed price if market price is lower than the agreed price.

Pemilik lahan ternak bertanggung jawab atas segalarisiko kegagalan pemeliharaan, perawatan dan pengembangan ayam sampai panen.

The farmer will take their own risk on chicken farming failure, maintenance and growing the chicken until the harvesting period.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/77 Exhibit E/77

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

37. IKATAN DAN PERJANJIAN (Lanjutan) 37. COMMITMENTS AND AGREEMENTS (Continued)

c. Kontrak Kerjasama Kemitraan (Lanjutan) c. Partnership Contract (Continued)

Untuk menjamin pembayaran dari usaha kemitraan baik wilayah barat dan wilayah timur, Perusahaan menerima jaminan aset yang disertai dengan surat kuasa sebesar nilai kontrak yang telah disepakati. Jaminan tersebut berupa tanah, bangunan, deposito dan kendaraan dengan nilai jaminan keseluruhan pada 31 Desember 2011 adalah sebesar Rp 265.541.411.305 (2010: Rp 204.525.215.390)

To secure the payment from this cooperative partnership in west and east area, the Company has received certain assets with its power of attorney which value is equal to the agreed contract as the collateral. The collateral consists of land, buildings, deposit and vehicles amounting to Rp 265,541,411,305 as of 31 December 2011 (2010: Rp 204,525,215,390)

Jaminan aset yang diterima Perusahaan tersebut tidak dicatat dalam laporan keuangan Perusahaan. Jaminan ini akan dikembalikan bila kerjasama kemitraan ini diakhiri.

The collateral assets received by the Company are not recorded in the Company's financial statements. The collaterals are returnable when the partnership contract is terminated.

Perjanjian kerjasama ini dilakukan dalam jangka waktu 1 tahun sejak ditanda-tanganinya surat perjanjian, dan dapat diperpanjang kembali sesuai kesepakatan antara Perusahaan dan pemilik lahan ternak.

This contract is valid for one year since date of signing of the agreement, and can be extended based on the approval from the Company and farm owners.

d. Fasilitas Pembiayaan Waad Al Murabahah d. Wa'd Al Murabahah Financing Facility Berdasarkan Surat Persetujuan Pemberian Kredit No.252/OL/301/XI/11, Perusahaan mendapatkan Fasilitas Pembiayaan Wad Al Murabahah dari PT Bank Muamalat Indonesia sebesar Rp 100.000.000.000 yang akan digunakan untuk pembelian bahan bangunan dan peralatan untuk pembangunan 4 unit commercial farm. Jangka waktu fasilitas adalah 60 bulan sejak penarikan pertama. Sampai dengan 31 Desember 2011 Perusahaan belum menggunakan Fasilitas pembiayaan ini.

Based on the Letter of Credit Agreement No.252/OL/301/XI/11, the Company obtained Wa'd Al Murabahah Financing Facility of PT Bank Muamalat Indonesia amounting to Rp 100 billion and will be used to purchase construction materials and equipment for the construction of four unit commercial farm. The term of loan is 60 months from the first drawdown. Up to 31 December 31, 2011 the Company has not used this financing facility.

Atas fasilitas pembiayaan ini Perusahaan harus menyerahkan jaminan berupa Tanah dan Bangunan (4 Commercial Farm) yang akan dibangun dengan dana pembiayaan dari PT Bank Muamalat Indonesia.

This financing facility is secured by the Land and Buildings (4 Commercial Farm) to be built with funding from the financing of PT Bank Muamalat Indonesia.

38. KONTINJENSI 38. CONTINGENCIES

a. Sesuai dengan Perkara No. 3079K/Pdt/1999 jo. Nomor : 513/Pdt/1995/PT.Bdg, tanggal 16 April 1997 jo. Nomor 12/Pdt/G/Bth/1993/PN.Bgr, tanggal 15 Februari 1995 antara Perusahaan melawan Indra Wirantono Cs. Perkara ini bermula dari adanya Penetapan Ketua Pengadilan Negeri Bogor Nomor : 02/DEL/SITA EKS/PDT/1993/PN.Bgr tanggal 7 Agustus 1993 yang akan melakukan sita eksekusiatas bangunan yang berdiri di atas tanah seluas 10,84 ha, sebagaimana tercantum dalam Sertifikat Hak Guna Bangunan No.02 /Cibinong, tercatat atas nama PT. Oerip Wirajaya Poultry. Saham Perseroan Terbatas tersebut telah diambil alih oleh Perusahaan pada tanggal 11 Januari 1991 dari Tn. H. Wirantono & PT. NV Perusahaan Dagang dan Industry Wirantono & Co. Ltd. N.V. sehingga sejak saat itu seluruh saham PT. Oerip Wirajaya Poultry dimiliki oleh Perusahaan, dan selanjutnya lokasi perusahaan tersebut dipergunakan sebagai salah satu lokasi pembibitan anak ayam umur sehari (DOC).

a. In relation to the Matter No. 3079K/Pdt/1999 jo. Number: 513/Pdt/1995/PT.Bdg, dated 16 April 1997 jo. Number 12/Pdt/G/Bth/1993/PN.Bgr, dated February 15, 1995 between Company oppose Indra Wirantono Cs. This matter began from the decreeissued by the State Court of Bogor No.: 02/DEL/SITA EKS/PDT/1993/PN.Bgr dated 7 August 1993 which will execute confiscation of the building consisting the land area of 10.84 ha, as stated in the certificate Hak Guna Bangunan No.02 / Cibinong, registered in the name of PT. Oerip Wirajaya Poultry. Such Companys shares have been taken over by the Company on 11 January 1991 from Mr. H. Wirantono & PT. Trade and Industry Company NV Wirantono & Co. Ltd. N.V. so since that time all the shares of PT. Oerip Wirajaya Poultry are owned by the Company, and then the location of suchcompany is used by the Company as breeding location for day old chicks (DOC).

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/79 Exhibit E/79

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

38. KONTINJENSI (Lanjutan) 38. CONTINGENCIES (Continued)

Berdasarkan Surat Kuasa No. 101/SK-LG Corp/VII/10 tanggal 5 Juli 2010, pada tanggal 12 Juli 2010, Perusahaan mengajukan Kontra Memori Kasasi kepada Mahkamah Agung Republik Indonesia melalui kantor Kepaniteraan Pengadilan Negeri Jakarta Selatan, dan sampai dengan tanggal penyelesaian laporan keuangan konsolidasian ini, Permohonan kasasi tersebut dalam tahap pemeriksaan di Mahkamah Agung Republik Indonesia.

Based on the Letter of Attorney No. 101/SK-LG Corp/VII/10 dated 5 July 2010, on 12 July 2010, the Company filed the Appeal Contra Memorandum to Supreme Court of Republic of Indonesia through the secretariat of South Jakarta District Court and until the date of completion of consolidated financial statements, the appeal is in the stage of examination in the Supreme Court of the Republic of Indonesia.

c. Pada tanggal 8 Desember 2010, Perusahaan

mengajukan permohonan banding kepada Pengadilan Tinggi Surabaya melalui Pengadilan Negeri Surabaya atas Putusan Pengadilan Negeri Surabaya No. 431/PDT.G/2010/PN.SBY antara Perusahaan melawan PT. Perkebunan Nusantara XI.

c. On December 8, 2010, the Company filed an appeal to the Supreme Court by the District Court of Surabaya and through Surabaya District Court on the decision of the Court of Justice in Surabaya No. 431/PDT.G/2010/PN.SBY between the Company oppose PT. Perkebunan Nusantara XI.

Setelah memeriksa bebas perkara, melalui putusan Nomor : 234/PDT/2011/PT.SBY tanggal 27 Mei 2011, Hakim Tinggi Pengadilan Tinggi Surabaya memberikan putusan dengan amar putusan diantaranya sebagai berikut :

After checking the matter freely, through decision No. 234/PDT/2011/PT.SBY dated 27 May 2011, High Court of Justice in Surabaya issued a decision verdict including the following:

- Membatalkan putusan Pengadilan Negeri

Surabaya tanggal 30 Nopember 2010 Nomor : 431/Pdt. G/2010/PN.Sby yang dimohonkan banding;

- Cancel the Surabaya District Court on 30 November 2010 No: 431/Pdt. G/2010/PN.Sby a request for appeal;

- Menyatakan sah Surat Sanggup a quo; - Declare promissory note a quo

- Menyatakan Perusahaan adalah pembawa dan

pemegang Surat Sanggup a quo yang sah; - Declare the Company is a promissory note

carrier and the holder of a valid a quo;

- Menyatakan bahwa perbuatan yang dilakukan PT Perkebunan Nusantara XI yang telah tidak membayar Surat Sanggup a quo adalah perbuatan wanprestasi.

- Declare that the acts committed by PT Nusantara Plantation XI who have not paid a quo promissory note is an act of default.

- Menyatakan sebagai akibat wanprestasi yang

dilakukan PT Perkebunan Nusantara XI, Perusahaan telah menderita kerugian material sebesar USD 8.650.000.

- Declare as a result of default by PT Nusantara Plantation XI, the Company has suffered material losses amounting to USD 8,650,000.

- Menghukum PT Perkebunan Nusantara XI untuk

membayar ganti rugi berupa kerugian material sebesar USD 8.650.000.

- Punish PT Nusantara Plantation XI to pay compensation of material losses amounting to USD 8,650,000.

Atas putusan tersebut, PT. Perkebunan Nusantara XI mengajukan permohonan Kasasi kepada Mahkamah Agung RI melalui Pengadilan Negeri Surabaya dengan permohonan agar Majelis Hakim Agung menolak gugatan Termohon Kasasi Perusahaan dan atas hal tersebut Perusahaan telah mengajukan Kontra Memori Kasasi dengan permohonan agar Majelis Hakim Agung menguatkan putusan Pengadilan Negeri Surabaya yang dimohonkan kasasi tersebut.

The verdict, PT. Perkebunan Nusantara XI apply cassation request to the Supreme Court of the Republic of Indonesia through High Court of Surabaya with a request to Supreme Judge of Cassation rejected the Respondent claims and The Company has filed a Contra Memory Appeals judge with a request that the Supreme Court upheld the ruling of High Court of Surabaya for the cassation.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/78 Exhibit E/78

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

38. KONTINJENSI (Lanjutan) 38. CONTINGENCIES (Continued)

Atas jual beli saham tersebut menimbulkan gugatan diantara para ahli waris sehingga terbit surat Penetapan tersebut di atas. Kemudian Perusahaan mengajukan bantahan melalui Pengadilan Negeri Bogor, dan melalui Putusan Nomor: 12/Pdt/G/Bth/1993/PN.Bgr, tanggal 15 Februari 1995, Pengadilan Negeri Bogor menyatakan bantahan Perusahaan tidak dapat diterima, selanjutnya Perusahaan mengajukan banding di Pengadilan Tinggi Jawa Barat di Bandung, dan selanjutnya dalam Putusan No. 513/Pdt/1995/PT.Bdg tanggal 18 September 1996, majelis hakim menyatakan bahwa gugatan bantahan dari Perusahaan tidak dapat diterima. Selanjutnya Perusahaan mengajukan kasasi, dan sampai dengan tanggal penyelesaian laporan keuangan konsolidasian ini,

The share purchase has sparked a lawsuit between the heirs raising such above determination letter. The Company filled objection through the State Court of Bogor, and through Decision Number: 12/Pdt/G/Bth/1993/PN.Bgr, dated 15 February 1995, the State Court of Bogor accordingly, declared an unacceptable objection, so the Company filed an appeal in Superior Court of West Java in Bandung, and then in the Decision No.513/Pdt/1995/PT.Bdg dated September 18, 1996, the judges stated that objection of the Companys lawsuit is not acceptable. Futher the Company filed an appeal to the Supreme Court, and until the date of completion of these consolidated financial statements,

Perusahaan belum menerima relaas pemberitahuan isi putusan kasasi dari Mahkamah Agung RI, namun demikian berdasarkan informasi dari website resmi Mahkamah Agung RI, atas perkara tersebut sudah putus dengan putusan Mahkamah Agung RI menolak permohonan kasasi yang diajukan oleh Perusahaan.

the Company has not received notification relaas of the decision from the Supreme Court, however, based on information from the official website of the Supreme Court, the case was already settled by the decision of the Supreme Court Indonesia which reject the appeal filed by the Company.

b. Pada tahun 2009, Capital Atlantic Limited

(Penggugat) mengajukan gugatan wan prestasi kepada The Law Debenture Trust Corporation (Tergugat I), Perusahaan (Tergugat II) dan JP Morgan Chase Bank, N.A. Jakarta Branch sebagai turut Tergugat.

b. During 2009, Capital Atlantic Limited (Plaintiff) proposed to sue The Law Debenture Trust Corporation (Defendant I), the Company (Defendant II) and JP Morgan Chase Bank, N.A. Jakarta Branch as another Defendant.

Gugatan ini diajukan di Pengadilan Negeri Jakarta Selatan, bermula karena Tergugat I telah melanggar janji (wan prestasi) dengan tidak menyerahkan saham yang seharusnya dimiliki oleh Penggugat yang diperoleh sebagai pengalihan saham milik Individual Beneficiary, yang timbul akibat restrukturisasi utangPerusahaan. Sesuai dengan Perjanjian (Offshore Trust Deed Agreement) semestinya Penggugat berkewajiban untuk menyerahkan saham milik Individual Beneficiary setelah restrukturisasi Perusahaan selesai.

This legal action was proposed at the State Court of South Jakarta, it was started when the Defendant I had failed to comply with an agreement by not transferring the shares that were supposed to be owned by the Plaintiff which were acquired as Individual Beneficiary transfer of shares ownership, incurred in connection with the loan restructuring of the Company. According to the Offshore Trust Deed Agreement, the Plaintiff is compulsorily required to transfer the share ownership under Individual Beneficiary after the restructuring process of the Company is completed.

Bahwa atas gugatan yang diajukan oleh Penggugat tersebut, Majelis Hakim Pengadilan Negeri Jakarta Selatan telah memberikan putusan dengan amar keputusan yang intinya menolak gugatan dari Penggugat. Bahwa atas putusan tersebut, Penggugat mengajukan banding dan Perusahaan sebagai Terbanding II melalui Kantor Hukum Soesilo Aribowo & Rekan mengajukan Kontra Memori Banding.

Upon the claim proposed by the Plaintiff, the Judges of the State Court of South Jakarta had decided to refuse the claim made by the Plaintiff. According to this decision, the Plaintiff proposed to appeal and the Company acting as a Defendant II through law firm Soesilo Aribowo & Partners had proposed a Counter Appeal Memorandum.

Dalam salah satu amar putusan Majelis Hakim Tinggi pada Pengadilan Tinggi DKI Jakarta menyatakan bahwa Pengadilan Negeri Jakarta Selatan tidak berwenang memeriksa dan mengadili perkara ini.

In one of the ruling of the High Council of Judges at the Jakarta High Court declared that the South Jakarta District Court was not authorized to investigate and prosecute this case.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/79 Exhibit E/79

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

38. KONTINJENSI (Lanjutan) 38. CONTINGENCIES (Continued)

Berdasarkan Surat Kuasa No. 101/SK-LG Corp/VII/10 tanggal 5 Juli 2010, pada tanggal 12 Juli 2010, Perusahaan mengajukan Kontra Memori Kasasi kepada Mahkamah Agung Republik Indonesia melalui kantor Kepaniteraan Pengadilan Negeri Jakarta Selatan, dan sampai dengan tanggal penyelesaian laporan keuangan konsolidasian ini, Permohonan kasasi tersebut dalam tahap pemeriksaan di Mahkamah Agung Republik Indonesia.

Based on the Letter of Attorney No. 101/SK-LG Corp/VII/10 dated 5 July 2010, on 12 July 2010, the Company filed the Appeal Contra Memorandum to Supreme Court of Republic of Indonesia through the secretariat of South Jakarta District Court and until the date of completion of consolidated financial statements, the appeal is in the stage of examination in the Supreme Court of the Republic of Indonesia.

c. Pada tanggal 8 Desember 2010, Perusahaan

mengajukan permohonan banding kepada Pengadilan Tinggi Surabaya melalui Pengadilan Negeri Surabaya atas Putusan Pengadilan Negeri Surabaya No. 431/PDT.G/2010/PN.SBY antara Perusahaan melawan PT. Perkebunan Nusantara XI.

c. On December 8, 2010, the Company filed an appeal to the Supreme Court by the District Court of Surabaya and through Surabaya District Court on the decision of the Court of Justice in Surabaya No. 431/PDT.G/2010/PN.SBY between the Company oppose PT. Perkebunan Nusantara XI.

Setelah memeriksa bebas perkara, melalui putusan Nomor : 234/PDT/2011/PT.SBY tanggal 27 Mei 2011, Hakim Tinggi Pengadilan Tinggi Surabaya memberikan putusan dengan amar putusan diantaranya sebagai berikut :

After checking the matter freely, through decision No. 234/PDT/2011/PT.SBY dated 27 May 2011, High Court of Justice in Surabaya issued a decision verdict including the following:

- Membatalkan putusan Pengadilan Negeri

Surabaya tanggal 30 Nopember 2010 Nomor : 431/Pdt. G/2010/PN.Sby yang dimohonkan banding;

- Cancel the Surabaya District Court on 30 November 2010 No: 431/Pdt. G/2010/PN.Sby a request for appeal;

- Menyatakan sah Surat Sanggup a quo; - Declare promissory note a quo

- Menyatakan Perusahaan adalah pembawa dan

pemegang Surat Sanggup a quo yang sah; - Declare the Company is a promissory note

carrier and the holder of a valid a quo;

- Menyatakan bahwa perbuatan yang dilakukan PT Perkebunan Nusantara XI yang telah tidak membayar Surat Sanggup a quo adalah perbuatan wanprestasi.

- Declare that the acts committed by PT Nusantara Plantation XI who have not paid a quo promissory note is an act of default.

- Menyatakan sebagai akibat wanprestasi yang

dilakukan PT Perkebunan Nusantara XI, Perusahaan telah menderita kerugian material sebesar USD 8.650.000.

- Declare as a result of default by PT Nusantara Plantation XI, the Company has suffered material losses amounting to USD 8,650,000.

- Menghukum PT Perkebunan Nusantara XI untuk

membayar ganti rugi berupa kerugian material sebesar USD 8.650.000.

- Punish PT Nusantara Plantation XI to pay compensation of material losses amounting to USD 8,650,000.

Atas putusan tersebut, PT. Perkebunan Nusantara XI mengajukan permohonan Kasasi kepada Mahkamah Agung RI melalui Pengadilan Negeri Surabaya dengan permohonan agar Majelis Hakim Agung menolak gugatan Termohon Kasasi Perusahaan dan atas hal tersebut Perusahaan telah mengajukan Kontra Memori Kasasi dengan permohonan agar Majelis Hakim Agung menguatkan putusan Pengadilan Negeri Surabaya yang dimohonkan kasasi tersebut.

The verdict, PT. Perkebunan Nusantara XI apply cassation request to the Supreme Court of the Republic of Indonesia through High Court of Surabaya with a request to Supreme Judge of Cassation rejected the Respondent claims and The Company has filed a Contra Memory Appeals judge with a request that the Supreme Court upheld the ruling of High Court of Surabaya for the cassation.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/81 Exhibit E/81

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

38. KONTINJENSI (Lanjutan) 38. CONTINGENCIES (Continued)

- Menghukum Perusahaan untuk menyerahkan Sertifikat Hak Milik Nomor : 1342 kepada Penggugat sebagai ahli waris alm. Yustinus Warsono;

- Punish the defendant to submit a Property Certificate Number: 1342 to the plaintiffs as heirs of late. Yustinus Warsono;

- Menghukum Perusahaan untuk membayar ganti rugi secara

material sebesar Rp 25.000.000 dan kerugian immaterial sebesar Rp 50.000.000.

- Punishing the Company to pay material losses compensation of Rp 25,000,000 and immaterial losses compensation amounted toRp 50,000,000.

Sampai dengan tanggal penyelesaian laporan keuangan konsolidasian ini, perkara ini sedang dalam proses pemeriksaan oleh Majelis Hakim di Pengadilan Negeri Mungkid.

Up to the completion of the consolidated financial statements, this legal action is under review of the Judges of the State Court Mungkid.

39. INFORMASI SEGMEN 39. SEGMENT INFORMATION

Informasi mengenai segmen operasi Grup adalah sebagai berikut: Operating segment information of the Group is as follows:

2 0 1 1 Ayam Umur Sehari/

Pakan Ternak/ Day Old Ayam Potong/ Kemitraan/ Lain-lain/ Jumlah/ Eliminasi/ Konsolidasian/ Feedmill Chicken Dressed Chicken Partnership Others Total Elimination Consolidation

Pendapatan RevenuesPihak Eksternal 1.459.200.885.937 167.477.923.810 269.119.924.914 2.005.282.339.445 128.049.949.522 4.029.131.023.628 - 4.029.131.023.628 External Parties Antar Segmen 1.366.080.823.062 205.251.239.250 53.301.539.613 196.743.610.999 13.447.337.564 1.834.824.550.488 ( 1.834.824.550.488) - Inter Segments

Jumlah Pendapatan 2.825.281.708.999 372.729.163.060 322.421.464.527 2.202.025.950.444 141.497.287.086 5.863.955.574.116 ( 1.834.824.550.488) 4.029.131.023.628 Total Revenues Hasil Result

Hasil Segmen 320.286.961.997 65.861.008.942 33.508.617.246 ( 30.668.264.860 ) 32.593.132.110 421.581.455.435 - 421.581.455.435 Segments Result

Beban Usaha ( 110.512.369.360 ) ( 57.278.526.205 ) ( 23.719.536.543 ) ( 37.416.903.917 ) ( 44.934.717.314) ( 273.862.053.339 ) - ( 273.862.053.339 ) Operating ExpensesBeban Usaha tidak Unallocated Operating

dapat Dialokasi - - - - ( 18.296.440.255) ( 18.296.440.255) - ( 18.296.440.255) Expenses Income (Loss) from Laba (Rugi) Usaha 209.774.592.637 8.582.482.737 9.789.080.703 ( 68.085.168.777 ) ( 30.638.025.459 ) 129.422.961.841 - 129.422.961.841 Operation Beban Keuangan ( 21.823.051.694 ) ( 22.755.400.508 ) ( 17.407.915.667 ) ( 17.811.336.537 ) ( 7.992.913.089) ( 87.790.617.495 ) - ( 87.790.617.495 ) Financial ChargesPendapatan (Beban)

Lain-lain ( 16.984.776.958 ) 10.884.576.988 544.723.780 ( 3.822.037.538 ) 1.758.070.480 ( 7.619.443.248 ) - ( 7.619.443.248 ) Other income (Charges)Laba Sebelum Pajak 170.966.763.985 ( 3.288.340.783 ) ( 7.074.111.184 ) ( 89.718.542.852 ) ( 36.872.868.068) 34.012.901.098 - 34.012.901.098 Income Before TaxBeban Pajak - - - - ( 10.560.634.634) ( 10.560.634.634) - ( 10.560.634.634) Tax Expense Laba Setelah pajak 170.966.763.985 ( 3.288.340.783 ) ( 7.074.111.184 ) ( 89.718.542.852 ) ( 47.433.502.702 ) 23.452.266.464 - 23.452.266.464 Income after Tax

Aset Segmen 1.607.964.038.278 863.177.875.199 815.778.744.610 313.233.926.769 917.918.518.443 4.518.073.103.299 ( 2.134.139.252.865 ) 2.383.933.850.434 Segment AssetsInvestasi pada

Perusahaan

Asosiasi - - - - 73.934.347.562 73.934.347.562 ( 73.934.347.562 ) - Investment in AssociatesKenaikan Penilaian Increment from Fair ValueKembali Nilai Wajar Revaluation of Assets

Aset dan Liabilitas - - - - - - - - and liabilities Aset tidak dapat

Dialokasi - - - - 257.669.081.726 257.669.081.726 - 257.669.081.726 Unallocated Assets

Jumlah Aset 1.607.964.038.278 863.177.875.199 815.778.744.610 313.233.926.769 1.249.521.947.731 4.849.676.532.587 ( 2.208.073.600.427 ) 2.641.602.932.160 Total Assets Liabilitas Segmen 868.898.757.462 687.901.045.758 195.043.432.786 429.780.896.630 1.165.750.107.251 3.347.374.239.887 ( 2.179.267.453.165 ) 1.168.106.786.722 Liabilitas tidak dapat

dialokasi - - - - 202.423.743.323 202.423.743.323 - 202.423.743.323 Unallocated LiabilitiesJumlah Liabilitas 868.898.757.462 687.901.045.758 195.043.432.786 429.780.896.630 1.368.173.850.574 3.549.797.983.210 ( 2.179.267.453.165) 1.370.530.530.045 Total Liabilities

Pengeluaran Barang

Modal 18.308.957.515 277.021.217.122 42.929.495.658 17.942.312.230 23.573.049.281 379.775.031.806 - 379.775.031.806 Capital Expenditures

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/80 Exhibit E/80

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

38. KONTINJENSI (Lanjutan) 38. CONTINGENCIES (Continued)

d. Pada tanggal 22 Juni 2011, PT Eraska Nofa telah mengajukan gugatan melalui Pengadilan Negeri Jakarta Selatan kepada Perusahaan (Tergugat 4).

d. On 22 June 2011, PT Eraska Nofa has filed with the South Jakarta District Court to the Company(Defendant 4).

Gugatan tersebut tercatat dalam register perkara No. 347/Pdt.G/2011/PN.Jkt.Sel. Dalam gugatannya, PT Eraska Nofa mengajukan permohonan sebagai berikut :

The lawsuit was recorded in the register case Number: 347/Pdt.G/2011/PN.Jkt.Sel. In his complaint, PT Eraska Nofa apply as follows:

- Menyatakan Para Tergugat telah melakukan

perbuatan melawan hukum; - To declare that the Defendants have

committed acts against the law.

- Menghukum Para Tergugat membayar ganti rugi material secara tanggung renteng kepada Penggugat sebesar USD 43.710.046.

- Punish the Defendants to pay material damages jointly and severally to the plaintiff amounted to USD 43,710,046

- Menghukum para tergugat membayar ganti rugi

material secara tanggung renteng kepada penggugat sebesar Rp 2.000.000.000

- Punish the defendant to pay claim damages material jointly and severally to the plaintiff as amount Rp 2,000,000,000

- Menghukum para Tergugat membayar uang

paksa sebesar Rp 100.000.000 per harinya apabila para tergugat lalai dalam menjalankan putusan perkara ini;

- Punish the Defendants forced to pay Rp 100,000,000 per day if the defendant negligent in carrying decision this case;

Sampai dengan tanggal penyelesaian laporan keuangan konsolidasian ini, perkara ini sedang dalam proses pemeriksaan oleh Pengadilan Negeri Jakarta Selatan.

Up to the completion of the consolidated financial statements, this legal action is under review of the South Jakarta District Court.

e. Pada tanggal 9 November 2011 terdaftar dalam

register perkara No. 62/Pdt.G/2011/PN.Mkd, melalui pengadilan negeri Mungkid, Perusahaantelah menerima gugatan dari Maria Magdalena Sudaryatmi. Gugatan ini bermula dari adanya pinjam meminjam sertifikat Hak Milik Nomor :1342, yang terletak di Perumda I No. 29 Rt 02 Rw 16 Ds Belang Wetan Kecamatan Klaten Utara, tercatat atas nama Yustinus Warsono (Almarhum adalah suami sah dari Penggugat) kepada Wiwoho (Turut Tergugat). Dan selanjutnya oleh Wiwoho Sertifikat hak Milik tersebut dijadikan sebagai jaminan kepada Perusahaan ketika Wiwoho hendak menjadi salah satu mitra peternak Perusahaan.

e. On 9 November 2011 registered in the register case No. 62/Pdt.G/2011/PN.Mkd, through the district court Mungkid, the Company has received a claim from Maria Magdalena Sudaryatmi. This lawsuit stems from the existence of a lending Proprietary certificate No. 1342, located at No. I Perumda 29 Rt 02 Rw 16 Ds Belang Klaten Wetan Northern District, recorded under the name of Yustinus Warsono (The deceased was the husband of the plaintiff's legitimate) to Wiwoho (Also Defendant). And subsequently by Wiwoho Certificate Ownership rights are pledged as collateral to the Company when Wiwoho wanted to be a breeder partner of the Company.

Sampai saat ini Wiwoho masih memiliki liabilitasyang belum diselesaikan kepada Perusahaan, karenanya jaminan belum diserahkan kembali kepada Wiwoho.

Until now Wiwoho still has outstanding obligations to the Company, therefore guarantees not be returned to Wiwoho.

Dalam gugatan tersebut, Penggugat mengajukan permohonan diantaranya sebagai berikut:

In the lawsuit, the plaintiff bring appeal including the following:

- Menyatakan perbuatan Perusahaan yang

membantu Wiwoho, dengan cara menerima jaminan sertifikat yang bukan miliknya adalah merupakan tindakan keliru dan melanggar hukum serta merugikan Penggugat;

- Act of the Company helping Wiwoho, by accepting the securitly certificate which is not his ownership erroneous act and violated the law and harm the plaintiff;

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/81 Exhibit E/81

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

38. KONTINJENSI (Lanjutan) 38. CONTINGENCIES (Continued)

- Menghukum Perusahaan untuk menyerahkan Sertifikat Hak Milik Nomor : 1342 kepada Penggugat sebagai ahli waris alm. Yustinus Warsono;

- Punish the defendant to submit a Property Certificate Number: 1342 to the plaintiffs as heirs of late. Yustinus Warsono;

- Menghukum Perusahaan untuk membayar ganti rugi secara

material sebesar Rp 25.000.000 dan kerugian immaterial sebesar Rp 50.000.000.

- Punishing the Company to pay material losses compensation of Rp 25,000,000 and immaterial losses compensation amounted toRp 50,000,000.

Sampai dengan tanggal penyelesaian laporan keuangan konsolidasian ini, perkara ini sedang dalam proses pemeriksaan oleh Majelis Hakim di Pengadilan Negeri Mungkid.

Up to the completion of the consolidated financial statements, this legal action is under review of the Judges of the State Court Mungkid.

39. INFORMASI SEGMEN 39. SEGMENT INFORMATION

Informasi mengenai segmen operasi Grup adalah sebagai berikut: Operating segment information of the Group is as follows:

2 0 1 1 Ayam Umur Sehari/

Pakan Ternak/ Day Old Ayam Potong/ Kemitraan/ Lain-lain/ Jumlah/ Eliminasi/ Konsolidasian/ Feedmill Chicken Dressed Chicken Partnership Others Total Elimination Consolidation

Pendapatan RevenuesPihak Eksternal 1.459.200.885.937 167.477.923.810 269.119.924.914 2.005.282.339.445 128.049.949.522 4.029.131.023.628 - 4.029.131.023.628 External Parties Antar Segmen 1.366.080.823.062 205.251.239.250 53.301.539.613 196.743.610.999 13.447.337.564 1.834.824.550.488 ( 1.834.824.550.488) - Inter Segments

Jumlah Pendapatan 2.825.281.708.999 372.729.163.060 322.421.464.527 2.202.025.950.444 141.497.287.086 5.863.955.574.116 ( 1.834.824.550.488) 4.029.131.023.628 Total Revenues Hasil Result

Hasil Segmen 320.286.961.997 65.861.008.942 33.508.617.246 ( 30.668.264.860 ) 32.593.132.110 421.581.455.435 - 421.581.455.435 Segments Result

Beban Usaha ( 110.512.369.360 ) ( 57.278.526.205 ) ( 23.719.536.543 ) ( 37.416.903.917 ) ( 44.934.717.314) ( 273.862.053.339 ) - ( 273.862.053.339 ) Operating ExpensesBeban Usaha tidak Unallocated Operating

dapat Dialokasi - - - - ( 18.296.440.255) ( 18.296.440.255) - ( 18.296.440.255) Expenses Income (Loss) from Laba (Rugi) Usaha 209.774.592.637 8.582.482.737 9.789.080.703 ( 68.085.168.777 ) ( 30.638.025.459 ) 129.422.961.841 - 129.422.961.841 Operation Beban Keuangan ( 21.823.051.694 ) ( 22.755.400.508 ) ( 17.407.915.667 ) ( 17.811.336.537 ) ( 7.992.913.089) ( 87.790.617.495 ) - ( 87.790.617.495 ) Financial ChargesPendapatan (Beban)

Lain-lain ( 16.984.776.958 ) 10.884.576.988 544.723.780 ( 3.822.037.538 ) 1.758.070.480 ( 7.619.443.248 ) - ( 7.619.443.248 ) Other income (Charges)Laba Sebelum Pajak 170.966.763.985 ( 3.288.340.783 ) ( 7.074.111.184 ) ( 89.718.542.852 ) ( 36.872.868.068) 34.012.901.098 - 34.012.901.098 Income Before TaxBeban Pajak - - - - ( 10.560.634.634) ( 10.560.634.634) - ( 10.560.634.634) Tax Expense Laba Setelah pajak 170.966.763.985 ( 3.288.340.783 ) ( 7.074.111.184 ) ( 89.718.542.852 ) ( 47.433.502.702 ) 23.452.266.464 - 23.452.266.464 Income after Tax

Aset Segmen 1.607.964.038.278 863.177.875.199 815.778.744.610 313.233.926.769 917.918.518.443 4.518.073.103.299 ( 2.134.139.252.865 ) 2.383.933.850.434 Segment AssetsInvestasi pada

Perusahaan

Asosiasi - - - - 73.934.347.562 73.934.347.562 ( 73.934.347.562 ) - Investment in AssociatesKenaikan Penilaian Increment from Fair ValueKembali Nilai Wajar Revaluation of Assets

Aset dan Liabilitas - - - - - - - - and liabilities Aset tidak dapat

Dialokasi - - - - 257.669.081.726 257.669.081.726 - 257.669.081.726 Unallocated Assets

Jumlah Aset 1.607.964.038.278 863.177.875.199 815.778.744.610 313.233.926.769 1.249.521.947.731 4.849.676.532.587 ( 2.208.073.600.427 ) 2.641.602.932.160 Total Assets Liabilitas Segmen 868.898.757.462 687.901.045.758 195.043.432.786 429.780.896.630 1.165.750.107.251 3.347.374.239.887 ( 2.179.267.453.165 ) 1.168.106.786.722 Liabilitas tidak dapat

dialokasi - - - - 202.423.743.323 202.423.743.323 - 202.423.743.323 Unallocated LiabilitiesJumlah Liabilitas 868.898.757.462 687.901.045.758 195.043.432.786 429.780.896.630 1.368.173.850.574 3.549.797.983.210 ( 2.179.267.453.165) 1.370.530.530.045 Total Liabilities

Pengeluaran Barang

Modal 18.308.957.515 277.021.217.122 42.929.495.658 17.942.312.230 23.573.049.281 379.775.031.806 - 379.775.031.806 Capital Expenditures

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/83 Exhibit E/83

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

40. TUJUAN DAN KEBIJAKAN MANAGEMENT RISIKO

KEUANGAN (Lanjutan) 40. FINANCIAL RISK MANAGEMENT OBJECTIVES AND

POLICIES (Continued)

Risiko Nilai Tukar Foreign Exchange Risk

Risiko nilai tukar adalah risiko dimana nilai wajar atau arus kas kontraktual masa datang dari suatu instrumen keuangan akan terpengaruh akibat perubahan nilai tukar. Eksposur Grup yang terpengaruh risiko nilai tukarterutama terkait dengan utang bank jangka pendek danpanjang.

Exchange rate risk is the risk that the fair value or future contractual cash flows of a financial instrument will be affected due to changes in exchange rates. Exposure of the Company and its subsidiaries are affected primarily exchange rate risk associated with short-term and long-term bank debts.

Selain utang bank jangka pendek dan panjang, Grupmemiliki eksposur dalam mata uang asing yang timbul dari transaksi operasionalnya. Eksposur tersebut timbul karena transaksi yang bersangkutan dilakukan dalam mata uang selain mata uang fungsional unit operasional atau pihak lawan.

In addition to short-term and long-term bank loans, the Company and its subsidiaries have exposure in foreign currency arising from operations. The exposure arising from transactions conducted in currencies other than the functional currency of the operational units or the opposition.

Grup mengendalikan risiko nilai tukar dengan memantau perubahan nilai tukar mata uang asing terhadap nilai Rupiah beserta dengan kondisi-kondisi yang dapat mempengaruhi hal tersebut, agar mendapatkan nilai tukar yang terbaik dalam setiap transaksi.

Group control the exchange rate risk by monitoring changes in exchange rates of foreign currencies to the Euro and the conditions that can affect it, in order to get the best exchange rate in each transaction.

Berikut adalah posisi aset dan liabilitas moneter dalam mata uang asing konsolidasian Grup, yang pembukuannya dalam mata uang asing, pada tanggal 31 Desember 2011 dan 2010 :

Here is the position of the consolidated monetary assets and liabilities denominated in foreign currencies of the Company and its subsidiaries, whose accounting records in foreign currencies, on 31 December 2011 and 2010:

2 0 1 1 2 0 1 0 Mata Uang

Asing / Foreign

Currencies

Ekuivalen Rupiah/

Equivalents in Rupiah

Mata Uang Asing /Foreign

Currencies

Ekuivalen Rupiah/

Equivalents in Rupiah

Aset AssetsKas dan setara kas USD 55.848 506.428.810 52.069 468.153.189 Cash and cash equivalentsUang muka pembelian USD 8.790.967 79.716.486.377 5.192.039 46.681.625.237 Purchases Advances Liabilitas Liabilities Utang usaha USD 10.230.289 92.768.263.591 5.530.526 49.724.957.727 Trade payables CHF 1.693 16.314.078 SGD 9.406 65.658.571 Utang bank USD 16.509.507 149.708.209.204 4.754.314 42.746.033.757 Bank loans Beban yang masih

harus dibayar USD 37.692 341.790.059 37.692 338.887.783 Acrued expenses SGD 8.807 61.423.691 8.807 61.479.000

( 162.673.085.436 ) ( 45.787.238.412)

Risiko Kredit Credit Risk

Risiko kredit adalah risiko bahwa Grup akan mengalami kerugian yang timbul dari pelanggan atau pihak lawan akibat gagal memenuhi liabilitas kontraktualnya. Manajemen berpendapat bahwa tidak terdapat risiko kredit yang terkonsentrasi secara signifikan. Grupmengendalikan risiko kredit dengan cara melakukan hubungan usaha dengan pihak lain yang memiliki kredibilitas, menetapkan kebijakan verifikasi dan otorisasi kredit, serta memantau kolektibilitas piutang secara berkala untuk mengurangi jumlah piutang tak tertagih.

Credit risk is the risk that the Company and its subsidiaries will incur a loss arising from the customer or other party due to failure to meet contractual obligations. Management believes that there are no concentrations of credit risk significantly. The Company and its subsidiaries control the credit risk by doing business relationships with other parties who have credibility, verification and authorization policies of credit, and to monitor the collectibility of receivables on a regular basis to reduce the amount of bad debts.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/82 Exhibit E/82

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

39. INFORMASI SEGMEN (Lanjutan) 39. SEGMENT INFORMATION (Continued)

2 0 1 0 Ayam Umur Sehari/

Pakan Ternak/ Day Old Ayam Potong/ Kemitraan/ Lain-lain/ Jumlah/ Eliminasi/ Konsolidasian/ Feedmill Chicken Dressed Chicken Partnership Others Total Elimination Consolidation Pendapatan Revenues

Pihak Eksternal 1.488.109.320.564 170.367.715.630 291.683.553.115 1.642.443.592.796 49.896.678.243 3.642.500.860.348( ) 3.642.500.860.348 External Parties Antar Segmen 1.126.256.035.910 216.962.263.050 26.132.088.184 231.118.038.537 9.147.260.377 1.609.615.686.058 (1.609.615.686.058) - Inter Segments Jumlah Pendapatan 2.614.365.356.474 387.329.978.680 317.815.641.299 1.873.561.631.333 59.043.938.620 5.252.116.546.406 (1.609.615.686.058) 3.642.500.860.348 Total Revenues

Hasil Result Hasil Segmen 233.596.441.527 81.055.486.457 26.695.851.678 (213.826.155) 10.311.743.147 351.445.696.656 - 351.445.696.656 Segments Result

Beban Usaha 96.886.747.351 50.586.925.968 19.637.826.081 26.449.097.240 15.254.105.047 208.814.701.687 - 208.814.701.687 Operating Expenses Beban Usaha tidak Dapat Unallocated Operating

Dialokasi - - - - 2.450.168.596 2.450.168.596 - 2.450.168.596 Expenses Income (Loss) from Laba (Rugi) Usaha 136.709.694.176 30.468.560.489 7.058.025.597 (26.662.923.395) (7.392.530.494) 140.180.826.373 - 140.180.826.373 Operation Beban Keuangan (11.552.774.721) (12.635.592.407) (11.507.491.132) (7.011.577.902) (6.060.433.737) (48.767.869.899) - (48.767.869.899) Financial Charges Pendapatan (Beban)

Lain-lain (4.961.483.789) 8.933.525.271 1.024.372.444 (1.751.395.608) (1.536.620.026) 1.708.398.292 - 1.708.398.292 Other income (Charges) Laba Sebelum Pajak 120.195.435.666 26.766.493.353 (3.425.093.091) (35.425.896.906) (14.989.584.256) 93.121.354.766 - 93.121.354.766 Income Before Tax Beban Pajak - - - - - 31.960.990.892 31.960.990.892 Tax Expense Bagian Laba Minoritas - - - - - 12.057.704 - 12.057.704 Portion of Minority Interest Laba Setelah pajak 120.195.435.666 26.766.493.353 (3.425.093.091) (35.425.896.906) (16.487.891.999) 61.148.306.170 61.148.306.170 Income after Tax

Aset Segmen 1.435.320.334.369 553.418.894.947 851.537.492.454 280.470.463.486 512.643.824.925 3.633.391.010.181 (1.689.562.394.773) 1.943.828.615.408 Segment Assets Investasi pada Perusahaan

Asosiasi - - - - 11.963.173.548 11.963.173.548 (11.963.173.548) - Investment in Associates Kenaikan Penilaian Increment from Fair Value

Kembali Nilai Wajar Revaluation of Assets and Aset dan Liabilitas Liabilities

Aset tidak dapat Dialokasi - - - - 93.629.967.560 93.629.967.560 - 93.629.967.560 Unallocated Assets

Jumlah Aset 1.435.320.334.369 553.418.894.947 851.537.492.454 280.470.463.486 618.236.966.033 3.738.984.151.289 (1.701.525.568.321) 2.037.458.582.968 Total Assets

Liabilitas Segmen 869.823.633.718 375.169.326.499 183.791.894.589 306.963.450.820 724.783.244.219 2.460.531.549.845 (1.684.270.575.796) 776.260.974.049 Segment Liabilities Liabilitas tidak dapat

Dialokasi - - - - 105.209.732.831 105.209.732.831 (77.023.599.769) 28.186.133.062 Unallocated Liabilities Jumlah Liabilitas 869.823.633.718 375.169.326.499 183.791.894.589 306.963.450.820 829.992.977.050 2.565.741.282.676 (1.761.294.175.565) 804.447.107.111 Total Liabilities

Pengeluaran Barang Modal - - - - - - - 259.039.243.767 Capital Expenditures

40. TUJUAN DAN KEBIJAKAN MANAGEMENT RISIKO KEUANGAN 40. FINANCIAL RISK MANAGEMENT OBJECTIVES AND POLICIES

Risiko-risiko utama yang timbul dari instrumen keuangan yang dimiliki Grup adalah risiko suku bunga, risiko nilai tukar, risiko kredit dan risiko likuiditas. Kegiatan operasional Grup dijalankan secara berhati-hati dengan mengelola risiko-risiko tersebut agar tidak menimbulkan potensi kerugian bagi Grup

The main risks arising from financial instruments held by the Company and its subsidiaries are interest rate risk, foreign exchange risk, credit risk and liquidity risk. The operations of the Company and its subsidiaries are handled carefully with managing such risks so as not to cause potential harm to the Company and its subsidiaries.

Risiko Suku Bunga Interest Rate Risk

Risiko suku bunga adalah risiko dimana nilai wajar atau arus kas kontraktual masa datang dari suatu intrumen keuangan perusahaan akan terpengaruh akibat perubahan suku bunga pasar. Eksposur Grupyang terpengaruh risiko suku bunga terutama terkait dengan utangbank dan liabilitas sewa pembiayaan.

Interest rate risk is the risk that the fair value or future contractual cash flows of a company's financial instruments will be affected due to changes in market interest rates. Exposure of the Company and its subsidiaries are affected primarily interest rate risk associated with bank loans and finance lease obligations.

Untuk meminimalkan risiko suku bunga, Grup mengelola beban bunga melalui kombinasi utang dengan suku bunga tetap dan suku bunga variabel, dengan mengevaluasi dengan suku bunga pasar. Manajemen juga melakukan penelaahan berbagai suku bunga yang ditawarkan oleh kreditur untuk mendapatkan suku bunga yang menguntungkan sebelum mengambil keputusan untuk melakukan perikatan utang.

To minimize interest rate risk, the Company and its subsidiaries manage interest expense through a combination of fixed-rate and variable interest rates, by evaluating the prevailing market rates. Management also reviews the various interest rates offered by lenders to obtain favorable interest rates before making a decision to engage in debt.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/83 Exhibit E/83

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

40. TUJUAN DAN KEBIJAKAN MANAGEMENT RISIKO

KEUANGAN (Lanjutan) 40. FINANCIAL RISK MANAGEMENT OBJECTIVES AND

POLICIES (Continued)

Risiko Nilai Tukar Foreign Exchange Risk

Risiko nilai tukar adalah risiko dimana nilai wajar atau arus kas kontraktual masa datang dari suatu instrumen keuangan akan terpengaruh akibat perubahan nilai tukar. Eksposur Grup yang terpengaruh risiko nilai tukarterutama terkait dengan utang bank jangka pendek danpanjang.

Exchange rate risk is the risk that the fair value or future contractual cash flows of a financial instrument will be affected due to changes in exchange rates. Exposure of the Company and its subsidiaries are affected primarily exchange rate risk associated with short-term and long-term bank debts.

Selain utang bank jangka pendek dan panjang, Grupmemiliki eksposur dalam mata uang asing yang timbul dari transaksi operasionalnya. Eksposur tersebut timbul karena transaksi yang bersangkutan dilakukan dalam mata uang selain mata uang fungsional unit operasional atau pihak lawan.

In addition to short-term and long-term bank loans, the Company and its subsidiaries have exposure in foreign currency arising from operations. The exposure arising from transactions conducted in currencies other than the functional currency of the operational units or the opposition.

Grup mengendalikan risiko nilai tukar dengan memantau perubahan nilai tukar mata uang asing terhadap nilai Rupiah beserta dengan kondisi-kondisi yang dapat mempengaruhi hal tersebut, agar mendapatkan nilai tukar yang terbaik dalam setiap transaksi.

Group control the exchange rate risk by monitoring changes in exchange rates of foreign currencies to the Euro and the conditions that can affect it, in order to get the best exchange rate in each transaction.

Berikut adalah posisi aset dan liabilitas moneter dalam mata uang asing konsolidasian Grup, yang pembukuannya dalam mata uang asing, pada tanggal 31 Desember 2011 dan 2010 :

Here is the position of the consolidated monetary assets and liabilities denominated in foreign currencies of the Company and its subsidiaries, whose accounting records in foreign currencies, on 31 December 2011 and 2010:

2 0 1 1 2 0 1 0 Mata Uang

Asing / Foreign

Currencies

Ekuivalen Rupiah/

Equivalents in Rupiah

Mata Uang Asing /Foreign

Currencies

Ekuivalen Rupiah/

Equivalents in Rupiah

Aset AssetsKas dan setara kas USD 55.848 506.428.810 52.069 468.153.189 Cash and cash equivalentsUang muka pembelian USD 8.790.967 79.716.486.377 5.192.039 46.681.625.237 Purchases Advances Liabilitas Liabilities Utang usaha USD 10.230.289 92.768.263.591 5.530.526 49.724.957.727 Trade payables CHF 1.693 16.314.078 SGD 9.406 65.658.571 Utang bank USD 16.509.507 149.708.209.204 4.754.314 42.746.033.757 Bank loans Beban yang masih

harus dibayar USD 37.692 341.790.059 37.692 338.887.783 Acrued expenses SGD 8.807 61.423.691 8.807 61.479.000

( 162.673.085.436 ) ( 45.787.238.412)

Risiko Kredit Credit Risk

Risiko kredit adalah risiko bahwa Grup akan mengalami kerugian yang timbul dari pelanggan atau pihak lawan akibat gagal memenuhi liabilitas kontraktualnya. Manajemen berpendapat bahwa tidak terdapat risiko kredit yang terkonsentrasi secara signifikan. Grupmengendalikan risiko kredit dengan cara melakukan hubungan usaha dengan pihak lain yang memiliki kredibilitas, menetapkan kebijakan verifikasi dan otorisasi kredit, serta memantau kolektibilitas piutang secara berkala untuk mengurangi jumlah piutang tak tertagih.

Credit risk is the risk that the Company and its subsidiaries will incur a loss arising from the customer or other party due to failure to meet contractual obligations. Management believes that there are no concentrations of credit risk significantly. The Company and its subsidiaries control the credit risk by doing business relationships with other parties who have credibility, verification and authorization policies of credit, and to monitor the collectibility of receivables on a regular basis to reduce the amount of bad debts.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/85 Exhibit E/85

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

41. KUASI-REORGANISASI 41. QUASI-REORGANIZATION

Krisis ekonomi yang terjadi sejak pertengahan tahun 1997, yang terutama disebabkan oleh melemahnya kurs mata uang Rupiah terhadap mata uang asing lainnya dan tingginya tingkat suku bunga pinjaman, ketatnya likuiditas, serta menurunnya tingkat kepercayaan investor, telah memberikan dampak buruk terhadap kinerja keuangan Perusahaan hingga memiliki saldo defisit yang signifikan pada neraca konsolidasian Perusahaan sebesar Rp 2.377.518.090.350 per tanggal 30 Juni 2009 (sebelum kuasi-reorganisasi). Meskipun saldo defisit Perusahaan masih berjumlah signifikan, Perusahaan telah berhasil membukukan laba bersih sebesar Rp 100.587.151.864 sejak tahun 2006 hingga 30 Juni 2009.

Economic crisis occurred during the mid 1997, which were significantly caused by the declining Rupiah currency against other foreign exchange and the rise of loan interest, tight liquidity, as well as the declining of investor's trust, had influenced deteriorating financial performance of the Company to suffer significant deficits balance of Rp 2,377,518,090,350 as of June 30, 2009 (before quasi-reorganization). Although the deficit balance of the Company remains in significant amount, the Company had successfully recorded net income amounted to Rp 100,587,151,864 since year 2006 up to June 30, 2009.

Manajemen berkeyakinan Perusahaan memiliki prospek usaha yang baik yang ditandai dengan keberhasilan Perusahaan dalam memperoleh hasil kinerja operasi yang positif selama beberapa tahun terakhir. Agar neraca konsolidasian Perusahaan dapat menunjukkan nilai sekarang dan tanpa dibebani oleh defisit, maka Perusahaan melaksanakan kuasi-reorganisasi pada tanggal 30 Juni 2009 sesuai dengan peraturan yang berlaku dan PSAK No. 51 (Revisi 2003) tentang Akuntansi Kuasi-Reorganisasi.

Management believes that the Company had promising business prospect which was indicated by the Company's success to generate positive result from operating performance during the last few years. In order to present the Company's consolidated balance sheets which shows current value and without being deteriorated by the deficits, therefore, the Company implemented quasi-reorganization on 30 June 2009 in accordance with the applicable regulation under PSAKNo. 51 (Revised 2003) concerning the "Accounting for Quasi-Reorganization".

Dalam kuasi-reorganisasi, aset dan liabilitas telah dinilai kembali yang menghasilkan kenaikan ekuitas sebesar Rp 108.380.711.649. Perhitungan eliminasi atas saldo defisit Perusahaan dengan urutan prioritas adalah sebagai berikut:

During a quasi-reorganization, the assets and liabilities which were revalued had generated increase in equityof Rp 108,380,711,649. The computation of elimination against the deficit balance of the Company on the basis of priority is as follows:

2 0 0 9 Eliminasi saldo defisit ( 2.377.518.090.350 ) Elimination of deficit balanceEliminasi kenaikan ekuitas dari Elimination of equity increment from

selisih penilaian aset dan liabilitas 108.380.711.649 fair value revaluation of assets and liabilities Tambahan modal disetor Bersih 237.474.479.595 Additional paid-in capital - Net Jumlah sisa saldo defisit ( 2.031.662.899.106 ) Total deficit balance

Selisih penilaian aset dan liabilitas merupakan selisih antara nilai tercatat aset dan liabilitas berdasarkanlaporan keuangan konsolidasian Perusahaan per tanggal 30 Juni 2009 yang telah diaudit dibandingkan dengannilai wajar aset dan liabilitas per tanggal 30 Juni 2009 berdasarkan laporan penilai independen.

The differences from revaluation of assets and liabilities represent carrying value of assets and liabilities according to the audited consolidated financial statements of the Company as of 30 June 2009 against the fair value of assets and liabilities as of 30 June 2009 on the basis of independent valuer's report.

Karena komponen ekuitas selain modal saham di atas tidak mencukupi untuk mengeliminasi saldo defisit, maka Perusahaan harus mereklasifikasi sebagian modal sahamnya menjadi tambahan modal disetor. Reklasifikasi ini dilakukan melalui penurunan nilai nominal saham tanpa mengurangi jumlah saham beredar (penurunan modal saham). Kelebihan modal saham sebagai hasil dari penurunan nilai nominal saham tidak dikembalikan kepada pemegang saham, namun dicatat sebagai tambahan modal disetor. Rincian penurunan nilai nominal saham adalah sebagai berikut:

Since the components of equity other than the share capital above were not sufficient to eliminate the deficit balance, then the Company shall reclassify its portion of share capital to additional paid-in capital. This reclassification was implemented by reducing the par value of share without reducing the number of outstanding shares (share capital reduction). The excess of share capital as a result of par value reduction are not returned to the shareholders, however, these are recorded as additional paid in capital. The details of reduction in par value of share are as follows:

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/84 Exhibit E/84

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

40. TUJUAN DAN KEBIJAKAN MANAGEMENT RISIKO

KEUANGAN (Lanjutan) 40. FINANCIAL RISK MANAGEMENT OBJECTIVES AND

POLICIES (Continued)

Risiko Likuiditas Liquidity Risk

Risiko likuiditas adalah risiko kerugian yang timbul karena Perusahaan tidak memiliki arus kas yang cukup untuk memenuhi liabilitasnya.

Liquidity risk is the risk of losses since the Company do not have sufficient cash flow to meet its obligations.

Dalam pengelolaan risiko likuiditas, manajemen memantau dan menjaga jumlah kas dan setara kas yang dianggap memadai untuk membiayai operasional Grupdan untuk mengatasi dampak fluktuasi arus kas. Manajemen juga melakukan evaluasi berkala atas proyeksi arus kas dan arus kas aktual, termasuk jadwal jatuh tempo utang, dan terus-menerus melakukan penelaahan pasar keuangan untuk mendapatkan sumber pendanaan yang optimal.

In managing liquidity risk, management to monitor and maintain the amount of cash and cash equivalents deemed adequate to finance the operations of the Company and its subsidiaries and to overcome the effects of fluctuations in cash flow. Management also conducts periodic evaluations of the cash flow projections and actual cash flows, including debt maturity schedules, and constantly reviewing the financial markets to obtain the optimal source of funding.

Manajemen Permodalan Capital Management

Tujuan utama dari pengelolaan modal Grup adalah untuk memastikan bahwa Grup mempertahankan rasio modal yang sehat dalam rangka mendukung bisnis dan memaksimalkan nilai pemegang saham serta untuk menjaga struktur optimal permodalan yang optimal untuk mengurangi biaya permodalan.

The primary objective of the Companys capital management is to ensure that it maintains healthy capital ratios in order to support its business and maximize shareholder value as well as maintain an optimal capital structure to reduce the cost of capital.

Grup mengelola strukur modal dan membuat penyesuaian terhadap struktur modal sehubungan dengan perubahan kondisi ekonomi. Grup memantau modalnya dengan menggunakan analisa gearing ratio (rasio utang terhadap modal), yakni membagi utang bersih terhadap jumlah modal.

The Group manages its capital structure and makes adjustments to it, in light of changes in economic conditions. The Group monitors its capital using gearing ratios, by dividing net debt with the total capital.

Struktur permodalan Grup terdiri dari ekuitas yang dapat diatribusikan kepada pemilik entitas induk (terdiri dari modal saham, saldo laba dan komponen ekuitas lainnya) dan pinjaman dan utang bersih (terdiri dari pinjaman bank jangka pendek, utang murabahah jangka pendek, utang sewa pembiayaan, pinjaman bank jangka panjang dan utang murabahah jangka panjang dikurangi dengan saldo kas).

The Groups capital structure consists of equity attributable to owners of the Company (consisting of capital stock, retained earnings and other equity components) and debts (consisting of short-term bank loan, short-term murabahah payables, lease liabilities, long-term loans and long-term murabahah payabbles, reduce by cash and cash equivalents).

Rasio utang bersih terhadap ekuitas pada tanggal 31 Desember 2011 dan 2010 adalah sebagai berikut:

Ratio of net debt to equity as of 31 December 2011 and 2010 are as follows:

2011 2010 Jumlah pinjaman dan utang 1.058.205.053.732 582.057.100.648 Total borrowings Dikurangi: Kas 50.729.456.147 36.334.443.271 Less: cash and cash equivalents Utang bersih 1.007.475.597.585 545.722.657.377 Net debt Ekuitas yang diatribusikan kepada

pemegang saham induk 1.245.499.849.885 1.232.823.139.291 Total equity attributable to owners

of the Company Rasio utang terhadap ekuitas 0,81 0,44 Gearing ratio

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/85 Exhibit E/85

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

41. KUASI-REORGANISASI 41. QUASI-REORGANIZATION

Krisis ekonomi yang terjadi sejak pertengahan tahun 1997, yang terutama disebabkan oleh melemahnya kurs mata uang Rupiah terhadap mata uang asing lainnya dan tingginya tingkat suku bunga pinjaman, ketatnya likuiditas, serta menurunnya tingkat kepercayaan investor, telah memberikan dampak buruk terhadap kinerja keuangan Perusahaan hingga memiliki saldo defisit yang signifikan pada neraca konsolidasian Perusahaan sebesar Rp 2.377.518.090.350 per tanggal 30 Juni 2009 (sebelum kuasi-reorganisasi). Meskipun saldo defisit Perusahaan masih berjumlah signifikan, Perusahaan telah berhasil membukukan laba bersih sebesar Rp 100.587.151.864 sejak tahun 2006 hingga 30 Juni 2009.

Economic crisis occurred during the mid 1997, which were significantly caused by the declining Rupiah currency against other foreign exchange and the rise of loan interest, tight liquidity, as well as the declining of investor's trust, had influenced deteriorating financial performance of the Company to suffer significant deficits balance of Rp 2,377,518,090,350 as of June 30, 2009 (before quasi-reorganization). Although the deficit balance of the Company remains in significant amount, the Company had successfully recorded net income amounted to Rp 100,587,151,864 since year 2006 up to June 30, 2009.

Manajemen berkeyakinan Perusahaan memiliki prospek usaha yang baik yang ditandai dengan keberhasilan Perusahaan dalam memperoleh hasil kinerja operasi yang positif selama beberapa tahun terakhir. Agar neraca konsolidasian Perusahaan dapat menunjukkan nilai sekarang dan tanpa dibebani oleh defisit, maka Perusahaan melaksanakan kuasi-reorganisasi pada tanggal 30 Juni 2009 sesuai dengan peraturan yang berlaku dan PSAK No. 51 (Revisi 2003) tentang Akuntansi Kuasi-Reorganisasi.

Management believes that the Company had promising business prospect which was indicated by the Company's success to generate positive result from operating performance during the last few years. In order to present the Company's consolidated balance sheets which shows current value and without being deteriorated by the deficits, therefore, the Company implemented quasi-reorganization on 30 June 2009 in accordance with the applicable regulation under PSAKNo. 51 (Revised 2003) concerning the "Accounting for Quasi-Reorganization".

Dalam kuasi-reorganisasi, aset dan liabilitas telah dinilai kembali yang menghasilkan kenaikan ekuitas sebesar Rp 108.380.711.649. Perhitungan eliminasi atas saldo defisit Perusahaan dengan urutan prioritas adalah sebagai berikut:

During a quasi-reorganization, the assets and liabilities which were revalued had generated increase in equityof Rp 108,380,711,649. The computation of elimination against the deficit balance of the Company on the basis of priority is as follows:

2 0 0 9 Eliminasi saldo defisit ( 2.377.518.090.350 ) Elimination of deficit balanceEliminasi kenaikan ekuitas dari Elimination of equity increment from

selisih penilaian aset dan liabilitas 108.380.711.649 fair value revaluation of assets and liabilities Tambahan modal disetor Bersih 237.474.479.595 Additional paid-in capital - Net Jumlah sisa saldo defisit ( 2.031.662.899.106 ) Total deficit balance

Selisih penilaian aset dan liabilitas merupakan selisih antara nilai tercatat aset dan liabilitas berdasarkanlaporan keuangan konsolidasian Perusahaan per tanggal 30 Juni 2009 yang telah diaudit dibandingkan dengannilai wajar aset dan liabilitas per tanggal 30 Juni 2009 berdasarkan laporan penilai independen.

The differences from revaluation of assets and liabilities represent carrying value of assets and liabilities according to the audited consolidated financial statements of the Company as of 30 June 2009 against the fair value of assets and liabilities as of 30 June 2009 on the basis of independent valuer's report.

Karena komponen ekuitas selain modal saham di atas tidak mencukupi untuk mengeliminasi saldo defisit, maka Perusahaan harus mereklasifikasi sebagian modal sahamnya menjadi tambahan modal disetor. Reklasifikasi ini dilakukan melalui penurunan nilai nominal saham tanpa mengurangi jumlah saham beredar (penurunan modal saham). Kelebihan modal saham sebagai hasil dari penurunan nilai nominal saham tidak dikembalikan kepada pemegang saham, namun dicatat sebagai tambahan modal disetor. Rincian penurunan nilai nominal saham adalah sebagai berikut:

Since the components of equity other than the share capital above were not sufficient to eliminate the deficit balance, then the Company shall reclassify its portion of share capital to additional paid-in capital. This reclassification was implemented by reducing the par value of share without reducing the number of outstanding shares (share capital reduction). The excess of share capital as a result of par value reduction are not returned to the shareholders, however, these are recorded as additional paid in capital. The details of reduction in par value of share are as follows:

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/87 Exhibit E/87

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

41. KUASI-REORGANISASI (Lanjutan) 41. QUASI-REORGANIZATION (Continued)

Sebelum kuasi- Setelah kuasi- reorganisasi/ reorganisasi/ Before quasi- After quasi- reorganization reorganization

ASET LANCAR CURRENT ASSETS Kas dan setara kas 30.377.940.624 30.377.940.624 Cash and cash equivalentsPiutang usaha Bersih 333.997.559.057 333.997.559.057 Trade receivables - NetPiutang lain-lain 12.716.354.040 12.716.354.040 Other receivablesPersediaan 310.225.766.069 310.225.766.069 InventoriesHewan ternak produksi -

berumur pendek 74.252.412.472 74.252.412.472 LivestockBeban dibayar di muka 6.231.622.664 6.231.622.664 Prepaid expensesPajak dibayar di muka 18.156.053.235 18.156.053.235 Prepaid taxesUang muka pembelian 63.433.063.615 63.433.063.615 Purchase advances Jumlah Aset Lancar 849.390.771.776 849.390.771.776 Total Current Assets

ASET TIDAK LANCAR NON-CURRENT ASSETSPiutang hubungan istimewa 41.281.893.732 41.281.893.732 Due from related partiesAset pajak tangguhan 53.324.432.350 53.324.432.350 Deferred tax assetsAset tetap Bersih 488.150.267.098 578.817.075.170 Property, plant and equipment - NetUang muka pembelian Advance for purchase of property,

aset tetap 34.041.680.360 34.041.680.360 plant and equipment Aset tetap yang tidak digunakan 32.927.526.213 50.641.429.790 Unutilized assetsUang jaminan yang dapat

diterima kembali 504.715.817 504.715.817 Refundable deposits

Jumlah Aset Tidak Lancar 650.230.515.570 758.611.227.219 Total Non-Current Assets

JUMLAH ASET 1.499.621.287.346 1.608.001.998.995 TOTAL ASSETS

LIABILITAS, HAK MINORITAS LIABILITIES, MINORITY INTERESTSDAN EKUITAS AND EQUITY

LIABILITAS LANCAR CURRENT LIABILITIES Utang bank jangka pendek 242.625.134.153 242.625.134.153 Short-term bank loansUtang usaha 152.012.734.758 152.012.734.758 Trade payablesBeban yang masih harus dibayar 10.593.360.393 10.593.360.393 Accrued expensesUtang pajak 8.065.066.267 8.065.066.267 Taxes payableLiabilitas jangka panjang Liabilitas lancar lainnya 15.249.828.546 15.249.828.546 Other Current Liabilities

yang jatuh tempo dalam Current Maturity of Long-waktu satu tahun Term loans obligation under Utang sewa pembiayaan 2.235.459.015 2.235.459.015 Finance lease

Jumlah Liabilitas Lancar 430.781.583.132 430.781.583.132 Total current liabilities

LIABILITAS TIDAK LANCAR NON-CURRENT LIABILITIESLiabilitas pajak tangguhan 286.605.775 286.605.775 Deferred tax liabilitesLiabilitas Imbalan kerja 21.116.136.386 21.116.136.386 Provision for employee benefitsLiabilitas jangka panjang

setelah dikurangi bagian yang jatuh tempo dalam waktu Long-term liabilities - net ofsatu tahun current maturity Utang sewa pembiayaan 3.139.810.515 3.139.810.515 Under finance lease

Jumlah Liabilitas Tidak Lancar 24.542.552.676 24.542.552.676 Total Non-Current Liabilities

JUMLAH LIABILITAS 455.324.135.808 455.324.135.808 TOTAL LIABILITIES HAK MINORITAS 49.236.893 49.236.893 MINORITY INTERESTS

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/86 Exhibit E/86

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

41. KUASI-REORGANISASI (Lanjutan) 41. QUASI-REORGANIZATION (Continued)

Nilai nominal/ Nilai nominal/ Par value Par value Lama / Old Baru / New Seri A 5.000 395 Seri A Seri B 3.000 395 Seri B Seri C 100 100 Seri C

Dampak penurunan nilai nominal saham Perusahaan di atas terhadap modal saham disetor adalah sebagai berikut:

Effects of the reduction in par value of shares of the Company above against the paid-in capital are as follows:

2 0 0 9

Modal disetor sebelum penurunan Paid in capital beforenilai nominal 3.184.291.525.400 reduction of share par value

Modal disetor setelah penurunan Paid in capital afternilai nominal 1.152.627.869.455 reduction of share par value

Tambahan modal disetor dari Additional paid-in capital in term of

penurunan nilai nominal saham 2.031.663.655.945 reduction of share par value

Pelaksanaan kuasi-reorganisasi secara hukum ini telah mendapat persetujuan dari Rapat Umum Pemegang Saham Luar Biasa pada tanggal 22 Desember 2009 tentang pelaksanaan kuasi-reorganisasi dan penurunan modal disetor dengan cara menurunkan nilai nominal saham yang didokumentasikan dalam akta No. 223 yang dibuat dihadapan Dr. Irawan Soerodjo, SH, MSi, Notaris di Jakarta.

The execution of this legal reorganization had been approved by the Extraordinary General Meeting of Shareholders dated 22 December 2009 concerning the execution of quasi-reorganization and reduction of paid-in capital by reducing the par value of shares which were documented on deed No. 223 made before Dr. lrawan Soerodjo, SH, MSi, a Notary in Jakarta.

Penggunaan penurunan nilai nominal saham tersebut terhadap sisa saldo defisit di atas adalah sebagai berikut:

The utilization of reduction in par value of shares on the elimination of remaining deficit balance is described as follows:

2 0 0 9 Tambahan modal disetor dari Additional paid-in capital from

penurunan nilai nominal saham 2.031.663.655.945 reduction of share par value Eliminasi terhadap sisa saldo Defisit ( 2.031.662.899.106 ) Elimination of deficit balance Tambahan modal disetor - Bersih 756.839 Additional paid-in capital - Net

Sisa agio saham dari penurunan nilai nominal saham sebesar Rp 756.839 disajikan sebagai tambahan modal disetor bersih pada laporan posisi keuangan.

The remaining additional paid in capital resulting from the reduction in par value of shares amounted to Rp 756,839 is presented as net - additional paid-in capital in the consolidated statement of financial position.

Posisi keuangan Perusahaan pada tanggal 30 Juni 2009 sebelum dan setelah kuasi-reorganisasi adalah sebagai berikut:

The financial position of the Company as of 30 June 2009 before and after the quasi-reorganization is as follows:

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/87 Exhibit E/87

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

41. KUASI-REORGANISASI (Lanjutan) 41. QUASI-REORGANIZATION (Continued)

Sebelum kuasi- Setelah kuasi- reorganisasi/ reorganisasi/ Before quasi- After quasi- reorganization reorganization

ASET LANCAR CURRENT ASSETS Kas dan setara kas 30.377.940.624 30.377.940.624 Cash and cash equivalentsPiutang usaha Bersih 333.997.559.057 333.997.559.057 Trade receivables - NetPiutang lain-lain 12.716.354.040 12.716.354.040 Other receivablesPersediaan 310.225.766.069 310.225.766.069 InventoriesHewan ternak produksi -

berumur pendek 74.252.412.472 74.252.412.472 LivestockBeban dibayar di muka 6.231.622.664 6.231.622.664 Prepaid expensesPajak dibayar di muka 18.156.053.235 18.156.053.235 Prepaid taxesUang muka pembelian 63.433.063.615 63.433.063.615 Purchase advances Jumlah Aset Lancar 849.390.771.776 849.390.771.776 Total Current Assets

ASET TIDAK LANCAR NON-CURRENT ASSETSPiutang hubungan istimewa 41.281.893.732 41.281.893.732 Due from related partiesAset pajak tangguhan 53.324.432.350 53.324.432.350 Deferred tax assetsAset tetap Bersih 488.150.267.098 578.817.075.170 Property, plant and equipment - NetUang muka pembelian Advance for purchase of property,

aset tetap 34.041.680.360 34.041.680.360 plant and equipment Aset tetap yang tidak digunakan 32.927.526.213 50.641.429.790 Unutilized assetsUang jaminan yang dapat

diterima kembali 504.715.817 504.715.817 Refundable deposits

Jumlah Aset Tidak Lancar 650.230.515.570 758.611.227.219 Total Non-Current Assets

JUMLAH ASET 1.499.621.287.346 1.608.001.998.995 TOTAL ASSETS

LIABILITAS, HAK MINORITAS LIABILITIES, MINORITY INTERESTSDAN EKUITAS AND EQUITY

LIABILITAS LANCAR CURRENT LIABILITIES Utang bank jangka pendek 242.625.134.153 242.625.134.153 Short-term bank loansUtang usaha 152.012.734.758 152.012.734.758 Trade payablesBeban yang masih harus dibayar 10.593.360.393 10.593.360.393 Accrued expensesUtang pajak 8.065.066.267 8.065.066.267 Taxes payableLiabilitas jangka panjang Liabilitas lancar lainnya 15.249.828.546 15.249.828.546 Other Current Liabilities

yang jatuh tempo dalam Current Maturity of Long-waktu satu tahun Term loans obligation under Utang sewa pembiayaan 2.235.459.015 2.235.459.015 Finance lease

Jumlah Liabilitas Lancar 430.781.583.132 430.781.583.132 Total current liabilities

LIABILITAS TIDAK LANCAR NON-CURRENT LIABILITIESLiabilitas pajak tangguhan 286.605.775 286.605.775 Deferred tax liabilitesLiabilitas Imbalan kerja 21.116.136.386 21.116.136.386 Provision for employee benefitsLiabilitas jangka panjang

setelah dikurangi bagian yang jatuh tempo dalam waktu Long-term liabilities - net ofsatu tahun current maturity Utang sewa pembiayaan 3.139.810.515 3.139.810.515 Under finance lease

Jumlah Liabilitas Tidak Lancar 24.542.552.676 24.542.552.676 Total Non-Current Liabilities

JUMLAH LIABILITAS 455.324.135.808 455.324.135.808 TOTAL LIABILITIES HAK MINORITAS 49.236.893 49.236.893 MINORITY INTERESTS

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/89 Exhibit E/89

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

43. PERISTIWA SETELAH TANGGAL NERACA (Lanjutan) 43. SUBSEQUENT EVENTS (Continued)

Fasilitas kredit ini digunakan untuk pembukaan LC/SKBDN pembelian bahan baku pakan ternak (Import & Lokal). Jangka waktu dari fasilitas kredit ini adalah 12 bulan sejak tanggal pengikatan kredit dan dikenakan bunga sebesar 1% diatas suku bunga deposito yang dijaminkan. Fasilitas ini dijamin dengan menyerahkan agunan berupa dana yang ditempatkan dalam bentuk deposito senilai USD 5.000.000 atau 100% dari LC/SKBDN yang diterbitkan dan tercatat atas nama Perusahaan.

The credit facility purpose is for the opening of the LC / SKBDN to purchase feed raw material (Import & Local). The term credit facility is 12 months from the date of the credit agreement and bears interest at 1% above the guaranteed deposit rates. The facility is secured by Deposit place by the Company amounted to USD 5,000,000 or 100% from the LC/SKBDN issued and registered by the Company.

ii. Berdasarkan Surat Persetujuan Pemberian Fasilitas

Line LC/SKBDN dan Kredit Modal Kerja No.5746/DKM/V/2012 tanggal 15 Mei 2012, Perusahaan mendapatkan tambahan fasilitas kredit dengan maksimal sebesar USD 15.000.000 dalam bentuk Sigh LC On-Off dengan fasilitas Kredit Modal Kerja. Fasilitas kredit ini digunakan untuk pembelian bahan baku pakan ternak (Import & Lokal). Jangka waktu dari fasilitas kredit adalah 24 bulan dan dikenakan bunga 11% p.a. Fasilitas ini dijamin dengan beberapa bidang tanah, mesin dan peralatan breeding farm serta persediaan yang dibiayai dengan fasilitas dari PT Bank Bukopin minimal sebesar Rp 222.656.250. Seluruh jaminan terikat cross collateralized dengan fasilitas Kredit Modal Kerja berdasarkan perjanjian kredit No.28 tanggal 26 Juli 2010 dan akta perubahahan Perjanjian Kredit No. 70 tanggal 17 Desember 2010 (Lihat Catatan 22).

ii. Based on the Letter Agreement Facilitation LC / SKBDN and Working Capital Loan No.5746/DKM/V/2012 dated 15 May 2012, the Company obtained additional credit facility with a maximum USD 15,000,000 in the form Sign LC On-Off with working capital loan. The credit facility purpose is for the opening of the LC / SKBDN to purchase feed raw material (Import & Local). The term credit facility is 24 months and bears interest at 11% annually the guaranteed deposit rates. The facility is secured by land, machinery, breeding farms equipment and the inventory financed with PT Bank Bukopin at least Rp 222,656,250. The collaterals are cross collateralized again working capital loan credit facility in credit agreement No.28 dated 26 July and deed of amandement credit agreement No.70 dated 17 December 2010 (See Note 22).

44. REKLASIFIKASI AKUN 44. RECLASSIFICATION OF ACCOUNTS

Beberapa akun dalam laporan keuangan konsolidasian pada tanggal 31 Desember 2010 telah direklasifikasi agar sesuai dengan penyajian akun pada tahun 2011 laporan keuangan konsolidasian. Rincian reklasifikasi ini antara lain:

Certain accounts in the 2010 consolidated financial statements have been reclassified to conform with the accounts presentation in 2011 consolidated financial statements.

31 Desember

2010 saldo sebelum

reklasifikasi/ 31 December 2010

before reclassification

Reklasifikasi/ Reclassification

31 Desember 2010 saldo

sesudah reklasifikasi/ 31 December 2010

after reclassification

A s e t A s s e t sBeban murabahah tangguhan 18.284.621.696 ( 18.284.621.696) - Deferred murabahah expenses Pajak dibayar dimuka 11.847.313.404 ( 4.823.649.648) 7.023.663.756 Prepaid taxes Tagihan pajak penghasilan - 4.823.649.648 4.823.649.648 Claims for tax refund Liabilitas Liabilities Utang murabahah jangka pendek

30.975.000.000

( 975.000.000

)

30.000.000.000

Short-term murabahah payables

Liabilitas jangka panjang yang jatuh tempo dalam waktu satu tahun :

Long term liabilities due

within one year: Utang murabahah 7.819.824.309 ( 3.520.601.031) 4.299.223.278 Murabahah payables

Liabilitas jangka panjang setelah dikurangi bagian yang jatuh tempo dalam waktu satu tahun :

Long term liabilities net of current maturities:

Utang murabahah 38.530.431.307 ( 13.789.020.665) 24.741.410.642 Murabahah payables

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/88 Exhibit E/88

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

41. KUASI-REORGANISASI (Lanjutan) 41. QUASI-REORGANIZATION (Continued)

Sebelum kuasi- Setelah kuasi- reorganisasi/ reorganisasi/ Before quasi- After quasi- reorganization reorganization

EKUITAS EQUITYModal disetor 3.184.291.525.400 3.184.291.525.400 Capital stockPenurunan nilai nominal saham - ( 2.031.663.655.945 ) Redudion of share par valueTambahan modal disetor - Bersih 237.474.479.595 756.839 Additional paid-in capital-Net Saldo laba Retained earning(Defisit) ( 2.377.518.090.350) - (Deficits) Jumlah Ekuitas 1.044.247.914.645 1.152.628.626.294 Total Stockholders' Equity JUMLAH LIABILITAS, HAK TOTAL LlABlLlTlES, MINORITY

MINORITAS DAN EKUITAS 1.499.621.287.346 1.608.001.998.995 INTERESTS AND EQUITY 42. PENERAPAN AWAL PSAK NO.50 (REVISI 2006) DAN

PSAK NO. 55 (REVISI 2006)

Laporan keuangan Grup pada tanggal dan untuk periode yang berakhir pada tanggal 31 Desember 2010 merupakan laporan keuangan konsolidasian pertama Perusahaan yang menerapkan PSAK No. 50 (Revisi 2006) dan PSAK No. 55 (Revisi 2006). Dalam menerapkan standar-standar tersebut di atas, Grup telah mengidentifikasi penyesuaian transisi berikut sesuai dengan Buletin Teknis No. 4 tentang Ketentuan Transisi untuk Penerapan Awal PSAK No. 50 (Revisi 2006) dan PSAK No. 55 (Revisi 2006) yang diterbitkan oleh Ikatan Akuntan Indonesia.

42. FIRST TIME ADOPTION OF PSAK NO. 50 (REVISED 2006) AND PSAK NO. 55 (REVISED 2006)

The consolidated financial statements as of and for the year ended 31 December 2010 are the first consolidated financial statements of Group which adopting PSAK No. 50 (revised 2006) and PSAK No. 55 (Revised 2006). In adopting the new standards above, the Group hasidentified the transition adjustments in accordance with Technical Bulletin No. 4 of the transitional provisions for the initial adoption of PSAK No. 50 (revised 2006) and PSAK No. 55 (revised 2006) issued by the Indonesian Institute of Accountants.

Dampak dari penyesuaian sehubungan dengan penerapan standar ini adalah:

The impact of transitional to PSAK No. 50 (Revised 2006) and PSAK No. 55 (revised 2006) are as follows :

Penyesuaian Setelah Dilaporkan transisi/ disesuaikan/ sebelumnya/ Transitional After As reported adjustment adjustments

A s e t A s s e t sPiutang usaha Trade receivables

Cadangan kerugian Allowance for penurunan nilai 126.052.725.268 8.741.559.531 134.794.284.799 impairment losses

Aktiva pajak tangguhan 39.941.534.065 1.748.311.906 41.689.845.971 Deferred tax assets Ekuitas Equity Saldo laba 26.032.049.687 ( 6.985.842.860) 19.046.206.827 Retained earnings

43. PERISTIWA SETELAH TANGGAL NERACA 43. SUBSEQUENT EVENTS

i. Berdasarkan Surat Persetujuan Pemberian Fasilitas Line LC/SKBDN dan Kredit Modal Kerja No.3623/DKM/IV/2012 tanggal 3 April 2012, Perusahaan mendapatkan tambahan fasilitas kredit dengan nilai maksimal sebesar USD 5.000.000 dalam bentuk Sign LC On-Off dengan fasilitas Kredit Modal Kerja.

i. Based on the Letter Agreement Facilitation LC / SKBDN and Working Capital Loan No.3623/DKM/IV/2012 dated 3 April 2012, the Company obtained additional credit facility with a maximum USD 5,000,000 in the form Sign LC On-Off with working capital loan.

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/89 Exhibit E/89

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

43. PERISTIWA SETELAH TANGGAL NERACA (Lanjutan) 43. SUBSEQUENT EVENTS (Continued)

Fasilitas kredit ini digunakan untuk pembukaan LC/SKBDN pembelian bahan baku pakan ternak (Import & Lokal). Jangka waktu dari fasilitas kredit ini adalah 12 bulan sejak tanggal pengikatan kredit dan dikenakan bunga sebesar 1% diatas suku bunga deposito yang dijaminkan. Fasilitas ini dijamin dengan menyerahkan agunan berupa dana yang ditempatkan dalam bentuk deposito senilai USD 5.000.000 atau 100% dari LC/SKBDN yang diterbitkan dan tercatat atas nama Perusahaan.

The credit facility purpose is for the opening of the LC / SKBDN to purchase feed raw material (Import & Local). The term credit facility is 12 months from the date of the credit agreement and bears interest at 1% above the guaranteed deposit rates. The facility is secured by Deposit place by the Company amounted to USD 5,000,000 or 100% from the LC/SKBDN issued and registered by the Company.

ii. Berdasarkan Surat Persetujuan Pemberian Fasilitas

Line LC/SKBDN dan Kredit Modal Kerja No.5746/DKM/V/2012 tanggal 15 Mei 2012, Perusahaan mendapatkan tambahan fasilitas kredit dengan maksimal sebesar USD 15.000.000 dalam bentuk Sigh LC On-Off dengan fasilitas Kredit Modal Kerja. Fasilitas kredit ini digunakan untuk pembelian bahan baku pakan ternak (Import & Lokal). Jangka waktu dari fasilitas kredit adalah 24 bulan dan dikenakan bunga 11% p.a. Fasilitas ini dijamin dengan beberapa bidang tanah, mesin dan peralatan breeding farm serta persediaan yang dibiayai dengan fasilitas dari PT Bank Bukopin minimal sebesar Rp 222.656.250. Seluruh jaminan terikat cross collateralized dengan fasilitas Kredit Modal Kerja berdasarkan perjanjian kredit No.28 tanggal 26 Juli 2010 dan akta perubahahan Perjanjian Kredit No. 70 tanggal 17 Desember 2010 (Lihat Catatan 22).

ii. Based on the Letter Agreement Facilitation LC / SKBDN and Working Capital Loan No.5746/DKM/V/2012 dated 15 May 2012, the Company obtained additional credit facility with a maximum USD 15,000,000 in the form Sign LC On-Off with working capital loan. The credit facility purpose is for the opening of the LC / SKBDN to purchase feed raw material (Import & Local). The term credit facility is 24 months and bears interest at 11% annually the guaranteed deposit rates. The facility is secured by land, machinery, breeding farms equipment and the inventory financed with PT Bank Bukopin at least Rp 222,656,250. The collaterals are cross collateralized again working capital loan credit facility in credit agreement No.28 dated 26 July and deed of amandement credit agreement No.70 dated 17 December 2010 (See Note 22).

44. REKLASIFIKASI AKUN 44. RECLASSIFICATION OF ACCOUNTS

Beberapa akun dalam laporan keuangan konsolidasian pada tanggal 31 Desember 2010 telah direklasifikasi agar sesuai dengan penyajian akun pada tahun 2011 laporan keuangan konsolidasian. Rincian reklasifikasi ini antara lain:

Certain accounts in the 2010 consolidated financial statements have been reclassified to conform with the accounts presentation in 2011 consolidated financial statements.

31 Desember

2010 saldo sebelum

reklasifikasi/ 31 December 2010

before reclassification

Reklasifikasi/ Reclassification

31 Desember 2010 saldo

sesudah reklasifikasi/ 31 December 2010

after reclassification

A s e t A s s e t sBeban murabahah tangguhan 18.284.621.696 ( 18.284.621.696) - Deferred murabahah expenses Pajak dibayar dimuka 11.847.313.404 ( 4.823.649.648) 7.023.663.756 Prepaid taxes Tagihan pajak penghasilan - 4.823.649.648 4.823.649.648 Claims for tax refund Liabilitas Liabilities Utang murabahah jangka pendek

30.975.000.000

( 975.000.000

)

30.000.000.000

Short-term murabahah payables

Liabilitas jangka panjang yang jatuh tempo dalam waktu satu tahun :

Long term liabilities due

within one year: Utang murabahah 7.819.824.309 ( 3.520.601.031) 4.299.223.278 Murabahah payables

Liabilitas jangka panjang setelah dikurangi bagian yang jatuh tempo dalam waktu satu tahun :

Long term liabilities net of current maturities:

Utang murabahah 38.530.431.307 ( 13.789.020.665) 24.741.410.642 Murabahah payables

These Consolidated Financial Statements are originally Issued in Indonesian language

Ekshibit E/90 Exhibit E/90

PT SIERAD PRODUCE Tbk DAN ENTITAS ANAK PT SIERAD PRODUCE Tbk AND SUBSIDIARIES

CATATAN ATAS LAPORAN KEUANGAN KONSOLIDASIAN NOTES TO CONSOLIDATED FINANCIAL STATEMENTS 31 DESEMBER 2011, 31 DESEMBER 2010 DAN 31 DECEMBER 2011, 31 DECEMBER 2010 AND

1 JANUARI 2010/ 31 DESEMBER 2009 1 JANUARY 2010/ 31 DECEMBER 2009 (Disajikan dalam Rupiah, kecuali dinyatakan lain) (Expressed in Rupiah, unless otherwise stated)

45. TANGGUNG JAWAB MANAJEMEN ATAS LAPORAN

KEUANGAN KONSOLIDASIAN Manajemen Perusahaan bertanggung jawab atas penyusunan laporan keuangan konsolidasian yang diselesaikan pada tanggal 21 Mei 2012.

45. MANAGEMENTS RESPONSIBILITY ON THE CONSOLIDATED FINANCIAL STATEMENTS

The Management of the Company is responsible for the preparation of the consolidated financial statements which were completed on 21 May 2012.

ContentsDaftar Isi

Kinerja SahamStock Performance 16

Laporan Dewan KomisarisReport from the Board of Commissioners 18

Laporan DireksiReport from the Board of Directors 24

7 Visi MisiVision Mission

2 Sekilas PerusahaanCompany in Brief

12 Ikhtisar KeuanganFinancial Highlights

8 Peristiwa PentingEvent Highlights

BroadeningLaporan Tahunan 2011 Annual Report

The Horizon

KANTOR PUSAT Head Office

Gedung Plaza City View Lantai 1Jl. Kemang Timur No. 22Jakarta 12510Tel. 021 - 719 3888Fax. 021 - 719 3889

www.sieradproduce.com

Annual ReportLaporan Tahunan 2011